Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|648
Gene name
LocationContig_120:7550..11804
Strand+
Gene length (bp)4254
Transcript length (bp)4041
Coding sequence length (bp)4041
Protein length (aa) 1347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 3.6E-75 726 1062
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 5.5E-26 619 694
PF17877 Dis3l2_C_term DIS3-like exonuclease 2 C terminal 2.9E-24 1114 1197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 8 1344 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 27 1345 0.0E+00
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 397 1169 2.0E-142
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 371 1166 4.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 387 1167 6.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 8 1344 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 27 1345 0.0E+00
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 397 1169 2.0E-142
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 371 1166 4.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 387 1167 6.0E-103
sp|Q8CI75|DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus GN=Dis3l2 PE=1 SV=1 383 1167 1.0E-97
sp|Q0V9R3|DI3L2_XENTR DIS3-like exonuclease 2 OS=Xenopus tropicalis GN=dis3l2 PE=2 SV=2 400 1167 4.0E-91
sp|Q09568|DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans GN=F48E8.6 PE=3 SV=2 398 1166 5.0E-89
sp|O14040|DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis32 PE=1 SV=1 533 1143 9.0E-79
sp|Q5U2P0|DI3L1_RAT DIS3-like exonuclease 1 OS=Rattus norvegicus GN=Dis3l PE=2 SV=2 623 1140 4.0E-66
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 621 1144 5.0E-65
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 398 1172 8.0E-65
sp|A0JN80|DI3L1_BOVIN DIS3-like exonuclease 1 OS=Bos taurus GN=DIS3L PE=2 SV=2 623 1140 2.0E-64
sp|Q8C0S1|DI3L1_MOUSE DIS3-like exonuclease 1 OS=Mus musculus GN=Dis3l PE=1 SV=2 623 1140 4.0E-64
sp|Q8TF46|DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens GN=DIS3L PE=1 SV=2 623 1140 7.0E-64
sp|Q5R5N8|DI3L1_PONAB DIS3-like exonuclease 1 OS=Pongo abelii GN=DIS3L PE=2 SV=1 623 1140 9.0E-64
sp|P0DM58|DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana GN=SOV PE=1 SV=1 369 1055 2.0E-63
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 621 1172 4.0E-63
sp|Q0WPN0|DI32L_ARATH Inactive exonuclease DIS3L2 OS=Arabidopsis thaliana GN=SOV PE=2 SV=1 369 1055 4.0E-62
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 607 1144 1.0E-61
sp|Q0P4R5|DI3L1_XENTR DIS3-like exonuclease 1 OS=Xenopus tropicalis GN=dis3l PE=2 SV=2 619 1140 1.0E-57
sp|Q6GN11|DI3L1_XENLA DIS3-like exonuclease 1 OS=Xenopus laevis GN=dis3l PE=2 SV=2 605 1140 2.0E-57
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 619 1148 3.0E-57
sp|Q17632|RRP44_CAEEL Probable exosome complex exonuclease RRP44 OS=Caenorhabditis elegans GN=dis-3 PE=3 SV=2 621 1143 7.0E-57
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 401 1148 1.0E-55
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 719 1114 2.0E-48
sp|Q9WZI1|RNR_THEMA Ribonuclease R OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rnr PE=3 SV=1 655 1148 2.0E-44
sp|O84402|RNR_CHLTR Ribonuclease R OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnr PE=3 SV=1 672 1149 6.0E-41
sp|Q9PK00|RNR_CHLMU Ribonuclease R OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnr PE=3 SV=1 672 1174 4.0E-40
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr1 PE=3 SV=1 720 1060 5.0E-40
sp|Q9Z848|RNR_CHLPN Ribonuclease R OS=Chlamydia pneumoniae GN=rnr PE=3 SV=1 672 1191 2.0E-38
sp|O67834|RNR_AQUAE Ribonuclease R OS=Aquifex aeolicus (strain VF5) GN=rnr PE=3 SV=1 653 1105 1.0E-30
sp|Q02146|RNR2_LACLA Ribonuclease R 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr2 PE=3 SV=3 717 1063 9.0E-28
sp|Q9PR88|RNR_UREPA Ribonuclease R OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rnr PE=3 SV=1 719 1065 5.0E-27
sp|P40611|RNR_VIBPA Ribonuclease R OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnr PE=3 SV=2 669 1155 6.0E-27
sp|Q9KNY1|RNR_VIBCH Ribonuclease R OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnr PE=3 SV=1 720 1148 3.0E-26
sp|Q98QL0|RNR_MYCPU Ribonuclease R OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rnr PE=3 SV=1 720 1063 3.0E-25
sp|P21499|RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) GN=rnr PE=1 SV=2 720 1065 3.0E-23
sp|P30851|RNR_SHIFL Ribonuclease R OS=Shigella flexneri GN=rnr PE=3 SV=4 720 1065 9.0E-23
sp|P75529|RNR_MYCPN Ribonuclease R OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rnr PE=3 SV=1 718 1057 3.0E-22
sp|P47350|RNR_MYCGE Ribonuclease R OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rnr PE=3 SV=1 676 1057 6.0E-22
sp|P44907|RNR_HAEIN Ribonuclease R OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnr PE=3 SV=1 668 1065 1.0E-21
sp|Q8K917|RNR_BUCAP Ribonuclease R OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnr PE=3 SV=1 716 1148 4.0E-21
sp|Q46363|ZAM_SYNY3 Acetazolamide conferring resistance protein zam OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zam PE=3 SV=1 760 1065 6.0E-20
sp|P57628|RNR_BUCAI Ribonuclease R OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnr PE=3 SV=2 658 1148 1.0E-19
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 726 1077 1.0E-15
sp|Q87IJ9|RNB_VIBPA Exoribonuclease 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnb PE=3 SV=1 709 1065 2.0E-15
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 709 1061 5.0E-15
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 709 1061 1.0E-14
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 645 1076 2.0E-14
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 709 1059 2.0E-13
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 724 1069 3.0E-13
sp|A1SWZ6|RNB_PSYIN Exoribonuclease 2 OS=Psychromonas ingrahamii (strain 37) GN=rnb PE=3 SV=1 725 1079 2.0E-11
sp|C3LW69|RNB_VIBCM Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnb PE=3 SV=1 709 1059 3.0E-11
sp|Q9KLE1|RNB_VIBCH Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnb PE=3 SV=1 709 1059 3.0E-11
sp|P54084|RNR_ACIFR Ribonuclease R (Fragment) OS=Acidithiobacillus ferrooxidans GN=rnr PE=3 SV=2 623 819 3.0E-11
sp|A5F0G1|RNB_VIBC3 Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnb PE=3 SV=1 709 1059 6.0E-11
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 726 810 9.0E-11
sp|P56123|RNR_HELPY Ribonuclease R OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rnr PE=3 SV=1 761 1061 3.0E-10
sp|B5XS03|RNB_KLEP3 Exoribonuclease 2 OS=Klebsiella pneumoniae (strain 342) GN=rnb PE=3 SV=1 725 1080 6.0E-09
sp|B0BP37|RNB_ACTPJ Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rnb PE=3 SV=1 726 1061 1.0E-07
sp|B3GXJ4|RNB_ACTP7 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rnb PE=3 SV=1 726 1061 1.0E-07
sp|A3N0B9|RNB_ACTP2 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rnb PE=3 SV=1 726 1061 2.0E-07
sp|A0KFR1|RNB_AERHH Exoribonuclease 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rnb PE=3 SV=1 712 1062 9.0E-07
sp|A4WAX5|RNB_ENT38 Exoribonuclease 2 OS=Enterobacter sp. (strain 638) GN=rnb PE=3 SV=1 726 860 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004540 ribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|648
MEQQQQQQAQQPPQQQAQASGVPGPTGRRLHIAHRRSPSELTPLMSMFANPGMEQLAIQQQIELLQQQQQQIQAT
HQQYVNMGMIPPGQPMAHNGAFNPLQPIGNMSQPAFQFPPQQNISMAPPNQNMSHRRNQSALPNMGMGPPPAPSS
GASGSTFGNFEAPPAHGRDNGGGRGGRGGGGGAGHQRRHSLALADAKKAAEIAQQKRTTTGFQFPASADKPDDEN
TKPSGFQPTPDPPVAQGSTRGRGGHGRSQSMAANGRGGSRMDGDFPPRRGGGMGHARTGSRNYEGNWRTPNHNQD
QSAGTGQSQAFQPGHRSRGSMNQSTSQIGAFQYNPNQPQLMQLPGQLMMPSIYGQQLNPMQIGQLQALQAAQING
QQFQGLQSSQHAGPGGGQQQQRKTLFTPYLPQASLPALLGDGQLVSGVLRVNKKNRSDAYVTTQDGLLDADIFIC
GSKDRNRALEGDLVAVELLDVDEVWAQKKEKEEKKKRKDITDTRSGSSSQQGSTSNQGEDGHPPEGGIRRRGSLR
QRPTQKKNDDVEVEGQSLLLVEEEEISDEQKPLYAGHIVAVIERVAGQMFSGTLGLLRPSSQATKEKQEAERAAR
DGGNSRQNDNRQQEKPKIVWFKPTDKRVPLIAIPTEQAPRDFVEKHQDYADRIFVACIKRWPITSLHPFGTLVEQ
LGRMGDLKVETDALLRDNNFSSDEFSDAVLRNVGHQDWSLAKEDESAMESRRDFRQEQIFTIDFDGSAELGNGIH
VKTASDGKIEIGIHVPDVSHFVKPNSLVDREARKRGTSVQLLNRFCPLLPPKLSSEICSLVPEQDRLTISVVFSV
NPHTGSVAEGDCWVGRSIVKSGGKVSLADMESALKDPSAFSDGIVSAKTVQILEGVAQKFREARLGAGGEPIAPL
RLFQQLDDDNNPVQENIFNSTQALEMIEELMHKANAYVAQRLAHGLPEKALLRRQAAPNPRRLQTFVERMTALGY
DVDASGSGALQNSLFKVDDPDLRKGMETLVLKSMQRAKYFIAGKTLKPLWSQYSHYSLNLPLYTHFASPTRRYAD
IVVHRQLEAVLSDGQIEFADDIDNLVKTAEACNTKKDSAHNAQEQSIHIESCRTMDKKRQEVDGDLLTEGIVLCV
YESAFDVLIPEWGFEKRVHCDQLPLKKAEFRKDKRVLELYWEKGIPSSAFVPEDERLKAGASQRMTNAMAAAKQA
EEAERAKREREEAARKQTETGTISTDDVDALFDDDDDNTSDLTEAIAGASLAERPTQSVPGSPSRTSNAAGALHR
TRSDSKVPVSDAADGRLNNKDKYMKLLKLREEGGDYIQDVTEMTRVPIILKTDLSKSPPCLTIRTLNPYAL*
Coding >Ophun1|648
ATGGAGCAGCAGCAGCAGCAGCAAGCGCAGCAGCCGCCGCAGCAACAGGCTCAGGCCAGCGGCGTCCCAGGCCCT
ACTGGGCGCCGGCTGCACATTGCCCATCGACGCAGTCCCTCCGAGTTGACGCCTTTGATGAGCATGTTTGCCAAC
CCAGGCATGGAGCAGCTGGCCATCCAGCAGCAGATCGAGCTCTTGCAGCAGCAGCAGCAGCAGATCCAGGCGACT
CACCAACAGTATGTTAACATGGGCATGATACCCCCCGGACAGCCCATGGCCCATAACGGGGCGTTCAATCCTTTG
CAGCCCATAGGCAACATGTCGCAGCCCGCTTTTCAGTTTCCGCCTCAACAGAATATATCGATGGCTCCTCCGAAC
CAGAACATGTCACATCGCCGTAATCAGTCGGCACTCCCCAACATGGGCATGGGTCCGCCCCCGGCGCCCTCGTCT
GGTGCTTCGGGCTCCACCTTCGGCAACTTCGAGGCCCCGCCGGCCCACGGCCGAGATAACGGCGGCGGACGAGGT
GGCCGTGGAGGCGGCGGCGGTGCCGGCCACCAGCGCAGACACTCCCTGGCTCTGGCTGACGCCAAAAAGGCCGCC
GAGATCGCCCAGCAGAAGCGCACCACGACGGGCTTCCAGTTCCCGGCATCCGCCGACAAGCCCGACGATGAGAAC
ACCAAGCCCTCTGGCTTCCAGCCGACCCCGGACCCTCCCGTAGCCCAGGGATCCACTCGCGGCCGGGGAGGCCAC
GGACGCAGCCAGAGCATGGCCGCCAACGGCCGCGGAGGCTCCCGCATGGACGGCGACTTTCCTCCGCGCCGCGGG
GGCGGCATGGGCCACGCCCGCACCGGCTCTCGTAACTACGAAGGCAACTGGCGCACTCCCAACCACAACCAGGAT
CAGTCCGCTGGCACCGGCCAGTCTCAGGCGTTTCAGCCCGGCCACCGGTCTCGGGGCTCCATGAATCAGTCTACG
TCACAGATCGGAGCTTTCCAGTACAATCCTAACCAACCGCAGCTGATGCAGCTACCGGGCCAGCTGATGATGCCT
TCCATATACGGCCAGCAGCTCAACCCGATGCAGATCGGCCAGCTCCAGGCCCTGCAGGCTGCCCAGATCAACGGC
CAGCAGTTTCAGGGTCTCCAGAGCTCCCAGCACGCGGGCCCGGGCGGCGGGCAGCAGCAGCAGCGCAAGACGCTC
TTCACTCCTTATCTACCTCAGGCGTCTCTCCCCGCCCTGCTGGGCGACGGCCAACTCGTCTCCGGCGTCTTGCGC
GTGAACAAGAAGAACCGAAGCGACGCCTACGTCACCACGCAGGATGGTCTCCTCGACGCCGACATCTTCATCTGC
GGCAGCAAGGACCGCAACCGAGCCCTGGAGGGAGATCTGGTCGCCGTCGAATTGCTCGACGTTGACGAGGTCTGG
GCTCAGAAGAAGGAAAAAGAAGAGAAGAAGAAACGCAAGGACATAACTGACACTCGCTCCGGCTCCTCCAGCCAG
CAGGGATCGACCTCGAACCAAGGTGAAGACGGCCACCCTCCGGAGGGCGGGATCCGCCGACGTGGCAGCCTGCGT
CAGCGGCCGACGCAGAAGAAGAACGATGATGTCGAGGTTGAGGGTCAAAGCCTGCTGCTTGTCGAGGAGGAAGAG
ATTAGCGACGAGCAGAAGCCCCTCTACGCCGGTCACATCGTCGCCGTCATTGAGCGCGTGGCCGGCCAAATGTTC
TCTGGCACTCTAGGTCTGCTGCGTCCCAGCAGCCAGGCCACCAAGGAGAAGCAGGAGGCGGAGAGGGCGGCTCGC
GATGGCGGAAACAGTCGCCAGAACGACAACCGGCAGCAGGAGAAGCCCAAGATTGTCTGGTTCAAGCCCACCGAC
AAGCGTGTGCCCCTAATCGCCATCCCTACGGAGCAGGCCCCCCGCGACTTCGTGGAGAAGCATCAGGATTATGCC
GACCGCATCTTTGTCGCCTGCATCAAGCGATGGCCCATTACCTCTCTGCACCCTTTTGGCACCCTGGTGGAACAG
CTGGGGCGCATGGGAGACCTCAAGGTCGAGACGGATGCTCTGCTGCGGGACAACAACTTTTCGTCTGACGAGTTC
TCCGATGCCGTTCTTCGCAACGTCGGTCATCAGGACTGGTCACTTGCCAAGGAGGACGAATCGGCCATGGAGTCG
CGTCGCGATTTCCGTCAAGAGCAGATCTTCACCATCGACTTTGACGGCAGCGCCGAGCTCGGCAACGGCATCCAC
GTCAAGACGGCGTCGGACGGCAAGATTGAGATTGGCATCCACGTGCCCGACGTGTCGCACTTTGTGAAGCCCAAC
TCGCTGGTGGACCGCGAGGCTAGGAAGCGTGGCACGTCGGTTCAGCTGCTCAACCGGTTCTGTCCGCTGCTTCCC
CCGAAGCTCTCGAGCGAGATTTGCTCCCTGGTGCCCGAGCAGGATCGGCTCACCATCAGCGTCGTCTTCAGCGTG
AACCCCCACACCGGATCCGTCGCAGAGGGCGACTGCTGGGTGGGCCGAAGCATCGTCAAGAGCGGAGGCAAGGTG
TCTCTCGCCGACATGGAGAGCGCCCTCAAGGATCCGTCGGCCTTTTCCGACGGCATCGTGTCCGCCAAGACGGTA
CAGATACTCGAGGGAGTGGCGCAGAAGTTCCGCGAAGCCCGGCTGGGCGCCGGGGGCGAACCCATCGCGCCGTTG
CGCCTCTTCCAGCAGCTCGACGACGACAACAACCCGGTGCAGGAGAACATCTTCAACTCGACGCAGGCGCTGGAG
ATGATTGAGGAGCTCATGCACAAGGCCAACGCCTACGTCGCGCAGCGTCTCGCCCATGGTCTTCCCGAAAAGGCG
CTGCTTCGCCGCCAGGCCGCCCCCAACCCGCGCCGCCTGCAGACGTTTGTCGAGCGCATGACGGCCCTCGGGTAC
GACGTGGATGCCTCGGGCAGCGGGGCCCTGCAAAACAGCCTGTTCAAGGTGGACGACCCGGACCTGCGCAAGGGC
ATGGAGACGCTGGTGCTCAAGTCGATGCAGCGGGCCAAGTACTTCATCGCGGGCAAGACGCTGAAGCCGCTCTGG
TCGCAGTACTCTCACTACTCACTGAACCTGCCGCTCTACACTCACTTTGCGTCGCCGACTCGTCGCTACGCAGAC
ATTGTCGTTCACCGACAGCTCGAGGCGGTGCTTTCGGACGGTCAGATCGAGTTTGCGGACGACATCGATAACTTG
GTCAAGACGGCCGAAGCGTGCAACACCAAGAAGGACTCGGCGCACAACGCTCAGGAGCAGAGCATCCACATCGAG
TCGTGCCGAACCATGGACAAGAAGCGTCAAGAGGTGGACGGCGACCTCCTCACCGAGGGCATCGTCCTCTGCGTC
TACGAATCGGCCTTTGACGTGCTCATCCCCGAGTGGGGCTTCGAGAAGCGCGTGCACTGCGACCAGCTGCCGCTC
AAGAAGGCCGAGTTCCGGAAGGACAAGCGGGTGTTGGAGCTGTACTGGGAGAAGGGGATCCCCAGCTCGGCCTTT
GTGCCGGAAGACGAGCGGCTCAAGGCCGGGGCGTCGCAGAGGATGACCAACGCCATGGCTGCGGCCAAGCAGGCG
GAGGAGGCGGAGCGGGCCAAGAGGGAGCGGGAGGAGGCGGCGCGCAAGCAGACGGAGACGGGCACCATATCGACG
GACGACGTCGACGCCCTGTTTGACGACGACGACGACAACACGTCGGACTTGACCGAGGCCATCGCCGGAGCCTCG
CTGGCGGAGCGGCCGACTCAGAGCGTGCCGGGCTCGCCGTCGCGCACGTCGAACGCGGCGGGCGCGCTGCACCGG
ACCCGGTCCGACTCCAAGGTGCCGGTGTCGGACGCGGCCGATGGACGGCTGAACAACAAGGACAAGTACATGAAG
CTCCTGAAGCTTCGGGAGGAGGGAGGCGACTACATTCAGGATGTGACGGAGATGACGCGGGTGCCCATCATCTTG
AAGACGGACCTGAGCAAGAGCCCTCCGTGCTTGACGATTCGAACGTTGAACCCCTACGCGCTGTAG
Transcript >Ophun1|648
ATGGAGCAGCAGCAGCAGCAGCAAGCGCAGCAGCCGCCGCAGCAACAGGCTCAGGCCAGCGGCGTCCCAGGCCCT
ACTGGGCGCCGGCTGCACATTGCCCATCGACGCAGTCCCTCCGAGTTGACGCCTTTGATGAGCATGTTTGCCAAC
CCAGGCATGGAGCAGCTGGCCATCCAGCAGCAGATCGAGCTCTTGCAGCAGCAGCAGCAGCAGATCCAGGCGACT
CACCAACAGTATGTTAACATGGGCATGATACCCCCCGGACAGCCCATGGCCCATAACGGGGCGTTCAATCCTTTG
CAGCCCATAGGCAACATGTCGCAGCCCGCTTTTCAGTTTCCGCCTCAACAGAATATATCGATGGCTCCTCCGAAC
CAGAACATGTCACATCGCCGTAATCAGTCGGCACTCCCCAACATGGGCATGGGTCCGCCCCCGGCGCCCTCGTCT
GGTGCTTCGGGCTCCACCTTCGGCAACTTCGAGGCCCCGCCGGCCCACGGCCGAGATAACGGCGGCGGACGAGGT
GGCCGTGGAGGCGGCGGCGGTGCCGGCCACCAGCGCAGACACTCCCTGGCTCTGGCTGACGCCAAAAAGGCCGCC
GAGATCGCCCAGCAGAAGCGCACCACGACGGGCTTCCAGTTCCCGGCATCCGCCGACAAGCCCGACGATGAGAAC
ACCAAGCCCTCTGGCTTCCAGCCGACCCCGGACCCTCCCGTAGCCCAGGGATCCACTCGCGGCCGGGGAGGCCAC
GGACGCAGCCAGAGCATGGCCGCCAACGGCCGCGGAGGCTCCCGCATGGACGGCGACTTTCCTCCGCGCCGCGGG
GGCGGCATGGGCCACGCCCGCACCGGCTCTCGTAACTACGAAGGCAACTGGCGCACTCCCAACCACAACCAGGAT
CAGTCCGCTGGCACCGGCCAGTCTCAGGCGTTTCAGCCCGGCCACCGGTCTCGGGGCTCCATGAATCAGTCTACG
TCACAGATCGGAGCTTTCCAGTACAATCCTAACCAACCGCAGCTGATGCAGCTACCGGGCCAGCTGATGATGCCT
TCCATATACGGCCAGCAGCTCAACCCGATGCAGATCGGCCAGCTCCAGGCCCTGCAGGCTGCCCAGATCAACGGC
CAGCAGTTTCAGGGTCTCCAGAGCTCCCAGCACGCGGGCCCGGGCGGCGGGCAGCAGCAGCAGCGCAAGACGCTC
TTCACTCCTTATCTACCTCAGGCGTCTCTCCCCGCCCTGCTGGGCGACGGCCAACTCGTCTCCGGCGTCTTGCGC
GTGAACAAGAAGAACCGAAGCGACGCCTACGTCACCACGCAGGATGGTCTCCTCGACGCCGACATCTTCATCTGC
GGCAGCAAGGACCGCAACCGAGCCCTGGAGGGAGATCTGGTCGCCGTCGAATTGCTCGACGTTGACGAGGTCTGG
GCTCAGAAGAAGGAAAAAGAAGAGAAGAAGAAACGCAAGGACATAACTGACACTCGCTCCGGCTCCTCCAGCCAG
CAGGGATCGACCTCGAACCAAGGTGAAGACGGCCACCCTCCGGAGGGCGGGATCCGCCGACGTGGCAGCCTGCGT
CAGCGGCCGACGCAGAAGAAGAACGATGATGTCGAGGTTGAGGGTCAAAGCCTGCTGCTTGTCGAGGAGGAAGAG
ATTAGCGACGAGCAGAAGCCCCTCTACGCCGGTCACATCGTCGCCGTCATTGAGCGCGTGGCCGGCCAAATGTTC
TCTGGCACTCTAGGTCTGCTGCGTCCCAGCAGCCAGGCCACCAAGGAGAAGCAGGAGGCGGAGAGGGCGGCTCGC
GATGGCGGAAACAGTCGCCAGAACGACAACCGGCAGCAGGAGAAGCCCAAGATTGTCTGGTTCAAGCCCACCGAC
AAGCGTGTGCCCCTAATCGCCATCCCTACGGAGCAGGCCCCCCGCGACTTCGTGGAGAAGCATCAGGATTATGCC
GACCGCATCTTTGTCGCCTGCATCAAGCGATGGCCCATTACCTCTCTGCACCCTTTTGGCACCCTGGTGGAACAG
CTGGGGCGCATGGGAGACCTCAAGGTCGAGACGGATGCTCTGCTGCGGGACAACAACTTTTCGTCTGACGAGTTC
TCCGATGCCGTTCTTCGCAACGTCGGTCATCAGGACTGGTCACTTGCCAAGGAGGACGAATCGGCCATGGAGTCG
CGTCGCGATTTCCGTCAAGAGCAGATCTTCACCATCGACTTTGACGGCAGCGCCGAGCTCGGCAACGGCATCCAC
GTCAAGACGGCGTCGGACGGCAAGATTGAGATTGGCATCCACGTGCCCGACGTGTCGCACTTTGTGAAGCCCAAC
TCGCTGGTGGACCGCGAGGCTAGGAAGCGTGGCACGTCGGTTCAGCTGCTCAACCGGTTCTGTCCGCTGCTTCCC
CCGAAGCTCTCGAGCGAGATTTGCTCCCTGGTGCCCGAGCAGGATCGGCTCACCATCAGCGTCGTCTTCAGCGTG
AACCCCCACACCGGATCCGTCGCAGAGGGCGACTGCTGGGTGGGCCGAAGCATCGTCAAGAGCGGAGGCAAGGTG
TCTCTCGCCGACATGGAGAGCGCCCTCAAGGATCCGTCGGCCTTTTCCGACGGCATCGTGTCCGCCAAGACGGTA
CAGATACTCGAGGGAGTGGCGCAGAAGTTCCGCGAAGCCCGGCTGGGCGCCGGGGGCGAACCCATCGCGCCGTTG
CGCCTCTTCCAGCAGCTCGACGACGACAACAACCCGGTGCAGGAGAACATCTTCAACTCGACGCAGGCGCTGGAG
ATGATTGAGGAGCTCATGCACAAGGCCAACGCCTACGTCGCGCAGCGTCTCGCCCATGGTCTTCCCGAAAAGGCG
CTGCTTCGCCGCCAGGCCGCCCCCAACCCGCGCCGCCTGCAGACGTTTGTCGAGCGCATGACGGCCCTCGGGTAC
GACGTGGATGCCTCGGGCAGCGGGGCCCTGCAAAACAGCCTGTTCAAGGTGGACGACCCGGACCTGCGCAAGGGC
ATGGAGACGCTGGTGCTCAAGTCGATGCAGCGGGCCAAGTACTTCATCGCGGGCAAGACGCTGAAGCCGCTCTGG
TCGCAGTACTCTCACTACTCACTGAACCTGCCGCTCTACACTCACTTTGCGTCGCCGACTCGTCGCTACGCAGAC
ATTGTCGTTCACCGACAGCTCGAGGCGGTGCTTTCGGACGGTCAGATCGAGTTTGCGGACGACATCGATAACTTG
GTCAAGACGGCCGAAGCGTGCAACACCAAGAAGGACTCGGCGCACAACGCTCAGGAGCAGAGCATCCACATCGAG
TCGTGCCGAACCATGGACAAGAAGCGTCAAGAGGTGGACGGCGACCTCCTCACCGAGGGCATCGTCCTCTGCGTC
TACGAATCGGCCTTTGACGTGCTCATCCCCGAGTGGGGCTTCGAGAAGCGCGTGCACTGCGACCAGCTGCCGCTC
AAGAAGGCCGAGTTCCGGAAGGACAAGCGGGTGTTGGAGCTGTACTGGGAGAAGGGGATCCCCAGCTCGGCCTTT
GTGCCGGAAGACGAGCGGCTCAAGGCCGGGGCGTCGCAGAGGATGACCAACGCCATGGCTGCGGCCAAGCAGGCG
GAGGAGGCGGAGCGGGCCAAGAGGGAGCGGGAGGAGGCGGCGCGCAAGCAGACGGAGACGGGCACCATATCGACG
GACGACGTCGACGCCCTGTTTGACGACGACGACGACAACACGTCGGACTTGACCGAGGCCATCGCCGGAGCCTCG
CTGGCGGAGCGGCCGACTCAGAGCGTGCCGGGCTCGCCGTCGCGCACGTCGAACGCGGCGGGCGCGCTGCACCGG
ACCCGGTCCGACTCCAAGGTGCCGGTGTCGGACGCGGCCGATGGACGGCTGAACAACAAGGACAAGTACATGAAG
CTCCTGAAGCTTCGGGAGGAGGGAGGCGACTACATTCAGGATGTGACGGAGATGACGCGGGTGCCCATCATCTTG
AAGACGGACCTGAGCAAGAGCCCTCCGTGCTTGACGATTCGAACGTTGAACCCCTACGCGCTGTAG
Gene >Ophun1|648
ATGGAGCAGCAGCAGCAGCAGCAAGCGCAGCAGCCGCCGCAGCAACAGGCTCAGGCCAGCGGCGTCCCAGGCCCT
ACTGGGCGCCGGCTGCACATTGCCCATCGACGCAGTCCCTCCGAGTTGACGCCTTTGATGAGCATGTTTGCCAAC
CCAGGCAGTGAGTCCTTCTCCCCTAACCCGAGACGCCACCTCCCGCCCGGACAGAGTCTCGGCCGAGGCGCTGCC
TCTCCCTCCGTTCTGGTTCTCTACCCCATCAGCCCCCGTCACCTCGCCATCTTGAGGGAAGCGCACAGAATGCTG
ATGTGGCCCTCTTCAGTGGAGCAGCTGGCCATCCAGCAGCAGATCGAGCTCTTGCAGCAGCAGCAGCAGCAGATC
CAGGCGACTCACCAACAGTATGTTAACATGGGCATGATACCCCCCGGACAGCCCATGGCCCATAACGGGGCGTTC
AATCCTTTGCAGCCCATAGGCAACATGTCGCAGCCCGCTTTTCAGTTTCCGCCTCAACAGAATATATCGATGGCT
CCTCCGAACCAGAACATGTCACATCGCCGTAATCAGTCGGCACTCCCCAACATGGGCATGGGTCCGCCCCCGGCG
CCCTCGTCTGGTGCTTCGGGCTCCACCTTCGGCAACTTCGAGGCCCCGCCGGCCCACGGCCGAGATAACGGCGGC
GGACGAGGTGGCCGTGGAGGCGGCGGCGGTGCCGGCCACCAGCGCAGACACTCCCTGGCTCTGGCTGACGCCAAA
AAGGCCGCCGAGATCGCCCAGCAGAAGCGCACCACGACGGGCTTCCAGTTCCCGGCATCCGCCGACAAGCCCGAC
GATGAGAACACCAAGCCCTCTGGCTTCCAGCCGACCCCGGACCCTCCCGTAGCCCAGGGATCCACTCGCGGCCGG
GGAGGCCACGGACGCAGCCAGAGCATGGCCGCCAACGGCCGCGGAGGCTCCCGCATGGACGGCGACTTTCCTCCG
CGCCGCGGGGGCGGCATGGGCCACGCCCGCACCGGCTCTCGTAACTACGAAGGCAACTGGCGCACTCCCAACCAC
AACCAGGATCAGTCCGCTGGCACCGGCCAGTCTCAGGCGTTTCAGCCCGGCCACCGGTCTCGGGGCTCCATGAAT
CAGTCTACGTCACAGATCGGAGCTTTCCAGTACAATCCTAACCAACCGCAGCTGATGCAGCTACCGGGCCAGCTG
ATGATGCCTTCCATATACGGCCAGCAGCTCAACCCGATGCAGATCGGCCAGCTCCAGGCCCTGCAGGCTGCCCAG
ATCAACGGCCAGCAGTTTCAGGGTCTCCAGAGCTCCCAGCACGCGGGCCCGGGCGGCGGGCAGCAGCAGCAGCGC
AAGACGCTCTTCACTCCTTATCTACCTCAGGCGTCTCTCCCCGCCCTGCTGGGCGACGGCCAACTCGTCTCCGGC
GTCTTGCGCGTGAACAAGAAGAACCGAAGCGACGCCTACGTCACCACGCAGGATGGTCTCCTCGACGCCGACATC
TTCATCTGCGGCAGCAAGGACCGCAACCGAGCCCTGGAGGGAGATCTGGTCGCCGTCGAATTGCTCGACGTTGAC
GAGGTCTGGGCTCAGAAGAAGGAAAAAGAAGAGAAGAAGAAACGCAAGGACATAACTGACACTCGCTCCGGCTCC
TCCAGCCAGCAGGGATCGACCTCGAACCAAGGTGAAGACGGCCACCCTCCGGAGGGCGGGATCCGCCGACGTGGC
AGCCTGCGTCAGCGGCCGACGCAGAAGAAGAACGATGATGTCGAGGTTGAGGGTCAAAGCCTGCTGCTTGTCGAG
GAGGAAGAGATTAGCGACGAGCAGAAGCCCCTCTACGCCGGTCACATCGTCGCCGTCATTGAGCGCGTGGCCGGC
CAAATGTTCTCTGGCACTCTAGGTCTGCTGCGTCCCAGCAGCCAGGCCACCAAGGAGAAGCAGGAGGCGGAGAGG
GCGGCTCGCGATGGCGGAAACAGTCGCCAGAACGACAACCGGCAGCAGGAGAAGCCCAAGATTGTCTGGTTCAAG
CCCACCGACAAGCGTGTGCCCCTAATCGCCATCCCTACGGAGCAGGCCCCCCGCGACTTCGTGGAGAAGCATCAG
GATTATGCCGACCGCATCTTTGTCGCCTGCATCAAGCGATGGCCCATTACCTCTCTGCACCCTTTTGGCACCCTG
GTGGAACAGCTGGGGCGCATGGGAGACCTCAAGGTCGAGACGGATGCTCTGCTGCGGGACAACAACTTTTCGTCT
GACGAGTTCTCCGATGCCGTTCTTCGCAACGTCGGTCATCAGGACTGGTCACTTGCCAAGGAGGACGAATCGGCC
ATGGAGTCGCGTCGCGATTTCCGTCAAGAGCAGATCTTCACCATCGACTTTGACGGCAGCGCCGAGCTCGGCAAC
GGCATCCACGTCAAGACGGCGTCGGACGGCAAGATTGAGATTGGCATCCACGTGCCCGACGTGTCGCACTTTGTG
AAGCCCAACTCGCTGGTGGACCGCGAGGCTAGGAAGCGTGGCACGTCGGTTCAGCTGCTCAACCGGTTCTGTCCG
CTGCTTCCCCCGAAGCTCTCGAGCGAGATTTGCTCCCTGGTGCCCGAGCAGGATCGGCTCACCATCAGCGTCGTC
TTCAGCGTGAACCCCCACACCGGATCCGTCGCAGAGGGCGACTGCTGGGTGGGCCGAAGCATCGTCAAGAGCGGA
GGCAAGGTGTCTCTCGCCGACATGGAGAGCGCCCTCAAGGATCCGTCGGCCTTTTCCGACGGCATCGTGTCCGCC
AAGACGGTACAGATACTCGAGGGAGTGGCGCAGAAGTTCCGCGAAGCCCGGCTGGGCGCCGGGGGCGAACCCATC
GCGCCGTTGCGCCTCTTCCAGCAGCTCGACGACGACAACAACCCGGTGCAGGAGAACATCTTCAACTCGACGCAG
GCGCTGGAGATGATTGAGGAGCTCATGCACAAGGCCAACGCCTACGTCGCGCAGCGTCTCGCCCATGGTCTTCCC
GAAAAGGCGCTGCTTCGCCGCCAGGCCGCCCCCAACCCGCGCCGCCTGCAGACGTTTGTCGAGCGCATGACGGCC
CTCGGGTACGACGTGGATGCCTCGGGCAGCGGGGCCCTGCAAAACAGCCTGTTCAAGGTGGACGACCCGGACCTG
CGCAAGGGCATGGAGACGCTGGTGCTCAAGTCGATGCAGCGGGCCAAGTACTTCATCGCGGGCAAGACGCTGAAG
CCGCTCTGGTCGCAGTACTCTCACTACTCACTGAACCTGCCGCTCTACACTCACTTTGCGTCGCCGACTCGTCGC
TACGCAGACATTGTCGTTCACCGACAGCTCGAGGCGGTGCTTTCGGACGGTCAGATCGAGTTTGCGGACGACATC
GATAACTTGGTCAAGACGGCCGAAGCGTGCAACACCAAGAAGGACTCGGCGCACAACGCTCAGGAGCAGAGCATC
CACATCGAGTCGTGCCGAACCATGGACAAGAAGCGTCAAGAGGTGGACGGCGACCTCCTCACCGAGGGCATCGTC
CTCTGCGTCTACGAATCGGCCTTTGACGTGCTCATCCCCGAGTGGGGCTTCGAGAAGCGCGTGCACTGCGACCAG
CTGCCGCTCAAGAAGGCCGAGTTCCGGAAGGACAAGCGGGTGTTGGAGCTGTACTGGGAGAAGGGGATCCCCAGC
TCGGCCTTTGTGCCGGAAGACGAGCGGCTCAAGGCCGGGGCGTCGCAGAGGATGACCAACGCCATGGCTGCGGCC
AAGCAGGCGGAGGAGGCGGAGCGGGCCAAGAGGGAGCGGGAGGAGGCGGCGCGCAAGCAGACGGAGACGGGCACC
ATATCGACGGACGACGTCGACGCCCTGTTTGACGACGACGACGACAACACGTCGGACTTGACCGAGGCCATCGCC
GGAGCCTCGCTGGCGGAGCGGCCGACTCAGAGCGTGCCGGGCTCGCCGTCGCGCACGTCGAACGCGGCGGGCGCG
CTGCACCGGACCCGGTCCGACTCCAAGGTGCCGGTGTCGGACGCGGCCGATGGACGGCTGAACAACAAGGACAAG
TACATGAAGCTCCTGAAGCTTCGGGAGGAGGGAGGCGACTACATTCAGGATGTGACGGAGATGACGCGGGTGCCC
ATCATCTTGAAGACGGACCTGAGCAAGAGCCCTCCGTGAGTTTCCGTGCGAGATTCCTTGAGAGGATGGGAGCTG
ACCAAAGACGACAGGTGCTTGACGATTCGAACGTTGAACCCCTACGCGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail