Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6468
Gene name
LocationContig_707:1583..3174
Strand-
Gene length (bp)1591
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16897 MMR_HSR1_Xtn C-terminal region of MMR_HSR1 domain 3.6E-39 242 348
PF02824 TGS TGS domain 1.0E-22 350 423
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.1E-19 123 218
PF02421 FeoB_N Ferrous iron transport protein B 2.7E-08 123 177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39729|RBG1_YEAST Ribosome-interacting GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBG1 PE=1 SV=1 58 424 0.0E+00
sp|Q9UT21|YFY7_SCHPO Uncharacterized GTP-binding protein C9.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.07c PE=2 SV=1 58 424 0.0E+00
sp|P32234|128UP_DROME GTP-binding protein 128up OS=Drosophila melanogaster GN=128up PE=2 SV=2 58 424 1.0E-175
sp|P43690|DRG1_XENLA Developmentally-regulated GTP-binding protein 1 OS=Xenopus laevis GN=drg1 PE=2 SV=1 58 424 1.0E-174
sp|Q9Y295|DRG1_HUMAN Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens GN=DRG1 PE=1 SV=1 58 424 2.0E-174
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39729|RBG1_YEAST Ribosome-interacting GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBG1 PE=1 SV=1 58 424 0.0E+00
sp|Q9UT21|YFY7_SCHPO Uncharacterized GTP-binding protein C9.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.07c PE=2 SV=1 58 424 0.0E+00
sp|P32234|128UP_DROME GTP-binding protein 128up OS=Drosophila melanogaster GN=128up PE=2 SV=2 58 424 1.0E-175
sp|P43690|DRG1_XENLA Developmentally-regulated GTP-binding protein 1 OS=Xenopus laevis GN=drg1 PE=2 SV=1 58 424 1.0E-174
sp|Q9Y295|DRG1_HUMAN Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens GN=DRG1 PE=1 SV=1 58 424 2.0E-174
sp|Q3MHP5|DRG1_BOVIN Developmentally-regulated GTP-binding protein 1 OS=Bos taurus GN=DRG1 PE=2 SV=1 58 424 2.0E-174
sp|P32233|DRG1_MOUSE Developmentally-regulated GTP-binding protein 1 OS=Mus musculus GN=Drg1 PE=1 SV=1 58 424 8.0E-174
sp|Q9SVA6|DRG3_ARATH Developmentally-regulated G-protein 3 OS=Arabidopsis thaliana GN=DRG3 PE=1 SV=1 58 424 8.0E-164
sp|Q54HP3|DRG1_DICDI Developmentally-regulated GTP-binding protein 1 homolog OS=Dictyostelium discoideum GN=drg1 PE=3 SV=1 60 424 8.0E-153
sp|Q9LQK0|DRG1_ARATH Developmentally-regulated G-protein 1 OS=Arabidopsis thaliana GN=DRG1 PE=1 SV=1 62 424 1.0E-144
sp|Q9CAI1|DRG2_ARATH Developmentally-regulated G-protein 2 OS=Arabidopsis thaliana GN=DRG2 PE=2 SV=1 62 424 3.0E-144
sp|Q54WT4|DRG2_DICDI Developmentally-regulated GTP-binding protein 2 homolog OS=Dictyostelium discoideum GN=drg2 PE=3 SV=1 62 424 7.0E-138
sp|P34280|YKK3_CAEEL Uncharacterized GTP-binding protein C02F5.3 OS=Caenorhabditis elegans GN=C02F5.3 PE=3 SV=2 62 424 3.0E-137
sp|P32235|GTP1_SCHPO GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtp1 PE=3 SV=2 62 424 6.0E-129
sp|Q9QXB9|DRG2_MOUSE Developmentally-regulated GTP-binding protein 2 OS=Mus musculus GN=Drg2 PE=1 SV=1 62 424 4.0E-128
sp|P55039|DRG2_HUMAN Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens GN=DRG2 PE=1 SV=1 62 424 1.0E-127
sp|Q58D56|DRG2_BOVIN Developmentally-regulated GTP-binding protein 2 OS=Bos taurus GN=DRG2 PE=2 SV=1 62 424 1.0E-124
sp|P53295|RBG2_YEAST Ribosome-interacting GTPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBG2 PE=1 SV=1 62 424 4.0E-115
sp|Q58722|Y1326_METJA Uncharacterized GTP-binding protein MJ1326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1326 PE=3 SV=1 72 422 3.0E-96
sp|P17103|Y1111_HALSA Uncharacterized GTP-binding protein VNG_1111G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1111G PE=3 SV=1 73 424 2.0E-57
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 83 245 3.0E-16
sp|A3CM33|OBG_STRSV GTPase Obg OS=Streptococcus sanguinis (strain SK36) GN=obg PE=3 SV=1 120 241 1.0E-15
sp|B8ZPS8|OBG_STRPJ GTPase Obg OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=obg PE=3 SV=1 120 267 1.0E-15
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 120 293 1.0E-15
sp|Q97QW8|OBG_STRPN GTPase Obg OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|B5E4J4|OBG_STRP4 GTPase Obg OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|Q8DPV8|OBG_STRR6 GTPase Obg OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|Q04KK7|OBG_STRP2 GTPase Obg OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|B1IBL9|OBG_STRPI GTPase Obg OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|B2IQ29|OBG_STRPS GTPase Obg OS=Streptococcus pneumoniae (strain CGSP14) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|A4VUC8|OBG_STRSY GTPase Obg OS=Streptococcus suis (strain 05ZYH33) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|A2RJQ6|OBG_LACLM GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|A4W0M2|OBG_STRS2 GTPase Obg OS=Streptococcus suis (strain 98HAH33) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|Q02XY2|OBG_LACLS GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|A8AWM9|OBG_STRGC GTPase Obg OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|Q4A6N4|OBG_MYCS5 GTPase Obg OS=Mycoplasma synoviae (strain 53) GN=obg PE=3 SV=1 120 241 2.0E-15
sp|B3PMC1|OBG_MYCA5 GTPase Obg OS=Mycoplasma arthritidis (strain 158L3-1) GN=obg PE=3 SV=1 120 323 3.0E-15
sp|Q9CF94|OBG_LACLA GTPase Obg OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=obg PE=3 SV=1 120 241 3.0E-15
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 83 244 3.0E-15
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 120 243 5.0E-15
sp|Q38WT4|OBG_LACSS GTPase Obg OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=obg PE=3 SV=1 21 241 5.0E-15
sp|B9KER3|OBG_CAMLR GTPase Obg OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=obg PE=3 SV=1 120 241 6.0E-15
sp|Q5WHS8|OBG_BACSK GTPase Obg OS=Bacillus clausii (strain KSM-K16) GN=obg PE=3 SV=1 120 265 7.0E-15
sp|Q8DUU2|OBG_STRMU GTPase Obg OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=obg PE=3 SV=1 120 241 7.0E-15
sp|Q24SP0|OBG_DESHY GTPase Obg OS=Desulfitobacterium hafniense (strain Y51) GN=obg PE=3 SV=1 121 241 8.0E-15
sp|Q043W1|OBG_LACGA GTPase Obg OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=obg PE=3 SV=1 83 224 8.0E-15
sp|Q1GSF4|OBG_SPHAL GTPase Obg OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=obg PE=3 SV=1 120 241 9.0E-15
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 83 291 1.0E-14
sp|Q7MA28|OBG_WOLSU GTPase Obg OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|Q65GM7|OBG_BACLD GTPase Obg OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|Q0RPF6|OBG_FRAAA GTPase Obg OS=Frankia alni (strain ACN14a) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|Q2G983|OBG_NOVAD GTPase Obg OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=obg PE=3 SV=2 120 299 1.0E-14
sp|B2G6R9|OBG_LACRJ GTPase Obg OS=Lactobacillus reuteri (strain JCM 1112) GN=obg PE=3 SV=1 40 241 1.0E-14
sp|A5VJ99|OBG_LACRD GTPase Obg OS=Lactobacillus reuteri (strain DSM 20016) GN=obg PE=3 SV=1 40 241 1.0E-14
sp|A8L1V6|OBG_FRASN GTPase Obg OS=Frankia sp. (strain EAN1pec) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|B4U3Q7|OBG_STREM GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|Q8Y6Z3|OBG_LISMO GTPase Obg OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|Q71ZD3|OBG_LISMF GTPase Obg OS=Listeria monocytogenes serotype 4b (strain F2365) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 120 241 1.0E-14
sp|Q92BH7|OBG_LISIN GTPase Obg OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=obg PE=3 SV=1 120 241 2.0E-14
sp|B8DHL1|OBG_LISMH GTPase Obg OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=obg PE=3 SV=1 120 241 2.0E-14
sp|A0AIY6|OBG_LISW6 GTPase Obg OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=obg PE=3 SV=1 120 241 2.0E-14
sp|A6Q4D2|OBG_NITSB GTPase Obg OS=Nitratiruptor sp. (strain SB155-2) GN=obg PE=3 SV=1 120 241 2.0E-14
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 95 241 2.0E-14
sp|Q74JN7|OBG_LACJO GTPase Obg OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=obg PE=3 SV=1 83 224 2.0E-14
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 120 241 2.0E-14
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 120 244 2.0E-14
sp|A0RR37|OBG_CAMFF GTPase Obg OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=obg PE=3 SV=1 120 271 3.0E-14
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|B2GBD0|OBG_LACF3 GTPase Obg OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=obg PE=3 SV=1 40 241 3.0E-14
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 120 283 3.0E-14
sp|Q03JJ8|OBG_STRTD GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|Q5M3C8|OBG_STRT2 GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|Q5LYR4|OBG_STRT1 GTPase Obg OS=Streptococcus thermophilus (strain CNRZ 1066) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 120 267 3.0E-14
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 120 267 3.0E-14
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 120 241 3.0E-14
sp|B1YJR9|OBG_EXIS2 GTPase Obg OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=obg PE=3 SV=1 120 284 4.0E-14
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 120 244 4.0E-14
sp|Q48SX8|OBG_STRPM GTPase Obg OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|P0DB53|OBG_STRPQ GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|P0DB52|OBG_STRP3 GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q1JLA1|OBG_STRPC GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q1JBB7|OBG_STRPB GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q5XBM1|OBG_STRP6 GTPase Obg OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q67SC6|OBG_SYMTH GTPase Obg OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q8P0I6|OBG_STRP8 GTPase Obg OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q99Z94|OBG_STRP1 GTPase Obg OS=Streptococcus pyogenes serotype M1 GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|Q30QP0|OBG_SULDN GTPase Obg OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=obg PE=3 SV=1 120 354 4.0E-14
sp|Q88VG4|OBG_LACPL GTPase Obg OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=obg PE=3 SV=1 38 241 4.0E-14
sp|Q98QK8|OBG_MYCPU GTPase Obg OS=Mycoplasma pulmonis (strain UAB CTIP) GN=obg PE=3 SV=1 120 242 4.0E-14
sp|Q1J652|OBG_STRPF GTPase Obg OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=obg PE=3 SV=1 120 241 4.0E-14
sp|A2RE30|OBG_STRPG GTPase Obg OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=obg PE=3 SV=1 120 241 5.0E-14
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 83 224 5.0E-14
sp|C0ZAL7|OBG_BREBN GTPase Obg OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=obg PE=3 SV=1 120 239 5.0E-14
sp|B8FUR9|OBG_DESHD GTPase Obg OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=obg PE=3 SV=1 121 241 5.0E-14
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 120 246 5.0E-14
sp|B9DSH7|OBG_STRU0 GTPase Obg OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=obg PE=3 SV=1 120 241 5.0E-14
sp|C0MBS1|OBG_STRE4 GTPase Obg OS=Streptococcus equi subsp. equi (strain 4047) GN=obg PE=3 SV=1 120 241 6.0E-14
sp|A7Z781|OBG_BACMF GTPase Obg OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=obg PE=3 SV=1 120 241 7.0E-14
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 120 241 7.0E-14
sp|Q9KDK0|OBG_BACHD GTPase Obg OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=obg PE=3 SV=1 120 241 8.0E-14
sp|Q2JDP2|OBG_FRASC GTPase Obg OS=Frankia sp. (strain CcI3) GN=obg PE=3 SV=1 120 263 8.0E-14
sp|A4WZ45|OBG_RHOS5 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=obg PE=3 SV=2 120 241 8.0E-14
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 120 283 9.0E-14
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 120 283 9.0E-14
sp|Q82C85|OBG_STRAW GTPase Obg OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|B7GIR2|OBG_ANOFW GTPase Obg OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|Q3IXX9|OBG_RHOS4 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|A3PQJ0|OBG_RHOS1 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|B9KW04|OBG_RHOSK GTPase Obg OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|P20964|OBG_BACSU GTPase Obg OS=Bacillus subtilis (strain 168) GN=obg PE=1 SV=1 120 241 1.0E-13
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|B2V0A8|OBG_CLOBA GTPase Obg OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|B5ZBV6|OBG_UREU1 GTPase Obg OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=obg PE=3 SV=1 120 300 1.0E-13
sp|B8H9P2|OBG_ARTCA GTPase Obg OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=obg PE=3 SV=1 120 255 1.0E-13
sp|B3WE52|OBG_LACCB GTPase Obg OS=Lactobacillus casei (strain BL23) GN=obg PE=3 SV=1 120 241 1.0E-13
sp|Q039J3|OBG_LACC3 GTPase Obg OS=Lactobacillus casei (strain ATCC 334) GN=obg PE=3 SV=1 120 241 2.0E-13
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 120 241 2.0E-13
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 120 297 2.0E-13
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 120 297 2.0E-13
sp|Q1DC95|OBG_MYXXD GTPase Obg OS=Myxococcus xanthus (strain DK 1622) GN=obg PE=3 SV=1 121 241 2.0E-13
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 120 241 2.0E-13
sp|A0JXJ8|OBG_ARTS2 GTPase Obg OS=Arthrobacter sp. (strain FB24) GN=obg PE=3 SV=1 120 229 2.0E-13
sp|A1R787|OBG_ARTAT GTPase Obg OS=Arthrobacter aurescens (strain TC1) GN=obg PE=3 SV=1 120 229 2.0E-13
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 120 241 2.0E-13
sp|A9WUU2|OBG_RENSM GTPase Obg OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=obg PE=3 SV=1 120 229 2.0E-13
sp|A8FFS8|OBG_BACP2 GTPase Obg OS=Bacillus pumilus (strain SAFR-032) GN=obg PE=3 SV=1 120 241 2.0E-13
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 120 244 2.0E-13
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 120 241 2.0E-13
sp|A0LPF9|OBG_SYNFM GTPase Obg OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=obg PE=3 SV=1 120 268 3.0E-13
sp|A6LQR9|OBG_CLOB8 GTPase Obg OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=obg PE=3 SV=1 120 297 3.0E-13
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 120 241 3.0E-13
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 120 244 3.0E-13
sp|B7JVH9|OBG_CYAP8 GTPase Obg OS=Cyanothece sp. (strain PCC 8801) GN=obg PE=3 SV=1 120 241 3.0E-13
sp|Q89AE7|OBG_BUCBP GTPase Obg OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=obg PE=3 SV=1 120 239 3.0E-13
sp|B4F2A8|OBG_PROMH GTPase Obg OS=Proteus mirabilis (strain HI4320) GN=obg PE=3 SV=1 120 241 4.0E-13
sp|A7H029|OBG_CAMC5 GTPase Obg OS=Campylobacter curvus (strain 525.92) GN=obg PE=3 SV=1 120 241 4.0E-13
sp|Q022G3|OBG_SOLUE GTPase Obg OS=Solibacter usitatus (strain Ellin6076) GN=obg PE=3 SV=1 121 241 4.0E-13
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 120 269 4.0E-13
sp|A9NF57|OBG_ACHLI GTPase Obg OS=Acholeplasma laidlawii (strain PG-8A) GN=obg PE=3 SV=1 120 267 4.0E-13
sp|A8EV83|OBG_ARCB4 GTPase Obg OS=Arcobacter butzleri (strain RM4018) GN=obg PE=3 SV=1 120 241 4.0E-13
sp|Q834V4|OBG_ENTFA GTPase Obg OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=obg PE=3 SV=1 120 241 4.0E-13
sp|Q2NW34|OBG_SODGM GTPase Obg OS=Sodalis glossinidius (strain morsitans) GN=obg PE=3 SV=1 120 241 5.0E-13
sp|Q8K9G1|OBG_BUCAP GTPase Obg OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=obg PE=3 SV=1 120 241 5.0E-13
sp|Q6F0U3|OBG_MESFL GTPase Obg OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=obg PE=3 SV=1 120 241 5.0E-13
sp|B3DVG9|OBG_METI4 GTPase Obg OS=Methylacidiphilum infernorum (isolate V4) GN=obg PE=3 SV=2 105 241 5.0E-13
sp|Q0PC41|OBG_CAMJE GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=obg PE=3 SV=1 120 224 6.0E-13
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 120 293 6.0E-13
sp|A1VXH9|OBG_CAMJJ GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=obg PE=3 SV=1 120 224 7.0E-13
sp|B1HVB2|OBG_LYSSC GTPase Obg OS=Lysinibacillus sphaericus (strain C3-41) GN=obg PE=3 SV=2 120 241 7.0E-13
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 120 241 7.0E-13
sp|A7I166|OBG_CAMHC GTPase Obg OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=obg PE=3 SV=1 120 204 7.0E-13
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 120 241 7.0E-13
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 107 241 7.0E-13
sp|A8Z6G0|OBG_CAMC1 GTPase Obg OS=Campylobacter concisus (strain 13826) GN=obg PE=3 SV=1 120 208 8.0E-13
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 120 251 9.0E-13
sp|P72931|OBG_SYNY3 GTPase Obg OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=obg PE=3 SV=1 120 241 9.0E-13
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 120 225 1.0E-12
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 120 241 1.0E-12
sp|Q49Y82|OBG_STAS1 GTPase Obg OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=obg PE=3 SV=1 120 241 1.0E-12
sp|B1XN32|OBG_SYNP2 GTPase Obg OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=obg PE=3 SV=1 75 243 1.0E-12
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 120 265 1.0E-12
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 120 241 1.0E-12
sp|A8FJQ1|OBG_CAMJ8 GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=obg PE=3 SV=1 120 224 1.0E-12
sp|A4SCP4|OBG_CHLPM GTPase Obg OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=obg PE=3 SV=1 120 241 1.0E-12
sp|Q8EWL0|OBG_MYCPE GTPase Obg OS=Mycoplasma penetrans (strain HF-2) GN=obg PE=3 SV=1 96 242 1.0E-12
sp|Q5HX70|OBG_CAMJR GTPase Obg OS=Campylobacter jejuni (strain RM1221) GN=obg PE=3 SV=1 120 224 1.0E-12
sp|Q3APF4|OBG_CHLCH GTPase Obg OS=Chlorobium chlorochromatii (strain CaD3) GN=obg PE=3 SV=1 120 241 1.0E-12
sp|C0QUB5|OBG_PERMH GTPase Obg OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=obg PE=3 SV=1 120 241 1.0E-12
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 120 241 2.0E-12
sp|A6QB70|OBG_SULNB GTPase Obg OS=Sulfurovum sp. (strain NBC37-1) GN=obg PE=3 SV=1 120 206 2.0E-12
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 120 241 2.0E-12
sp|B8CSY3|OBG_SHEPW GTPase Obg OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=obg PE=3 SV=1 120 241 2.0E-12
sp|Q2LR77|OBG_SYNAS GTPase Obg OS=Syntrophus aciditrophicus (strain SB) GN=obg PE=3 SV=2 86 241 2.0E-12
sp|A9VIR5|OBG_BACWK GTPase Obg OS=Bacillus weihenstephanensis (strain KBAB4) GN=obg PE=3 SV=1 120 241 2.0E-12
sp|Q7NB30|OBG_MYCGA GTPase Obg OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=obg PE=3 SV=2 120 219 2.0E-12
sp|Q97JL4|OBG_CLOAB GTPase Obg OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=obg PE=3 SV=1 120 241 2.0E-12
sp|B7KIC1|OBG_CYAP7 GTPase Obg OS=Cyanothece sp. (strain PCC 7424) GN=obg PE=3 SV=1 75 270 2.0E-12
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 120 241 2.0E-12
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 120 241 2.0E-12
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 120 241 2.0E-12
sp|Q6D9C3|OBG_PECAS GTPase Obg OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=obg PE=3 SV=1 121 241 2.0E-12
sp|A5UI23|OBG_HAEIG GTPase Obg OS=Haemophilus influenzae (strain PittGG) GN=obg PE=3 SV=1 121 241 2.0E-12
sp|Q7VK84|OBG_HELHP GTPase Obg OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|A9AXD9|OBG_HERA2 GTPase Obg OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|A4WEZ6|OBG_ENT38 GTPase Obg OS=Enterobacter sp. (strain 638) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|B8D7S4|OBG_BUCAT GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|P57469|OBG_BUCAI GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|B8D9H2|OBG_BUCA5 GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|A5UDJ7|OBG_HAEIE GTPase Obg OS=Haemophilus influenzae (strain PittEE) GN=obg PE=3 SV=1 121 241 3.0E-12
sp|A7H1H0|OBG_CAMJD GTPase Obg OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=obg PE=3 SV=1 120 224 3.0E-12
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 38 241 3.0E-12
sp|B8GQQ3|OBG_THISH GTPase Obg OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|P95722|OBG_STRCO GTPase Obg OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=obg PE=1 SV=1 120 241 3.0E-12
sp|B3CQ33|OBG_ORITI GTPase Obg OS=Orientia tsutsugamushi (strain Ikeda) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|A5CDM6|OBG_ORITB GTPase Obg OS=Orientia tsutsugamushi (strain Boryong) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|Q2NCX8|OBG_ERYLH GTPase Obg OS=Erythrobacter litoralis (strain HTCC2594) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 99 207 3.0E-12
sp|Q7MYX6|OBG_PHOLL GTPase Obg OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=obg PE=3 SV=1 121 241 3.0E-12
sp|Q3AF51|OBG_CARHZ GTPase Obg OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=obg PE=3 SV=1 121 241 3.0E-12
sp|B7IIV2|OBG_BACC2 GTPase Obg OS=Bacillus cereus (strain G9842) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|Q1WT46|OBG_LACS1 GTPase Obg OS=Lactobacillus salivarius (strain UCC118) GN=obg PE=3 SV=1 76 241 3.0E-12
sp|Q5R039|OBG_IDILO GTPase Obg OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 120 241 3.0E-12
sp|Q7VP37|OBG_HAEDU GTPase Obg OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=obg PE=3 SV=1 121 307 4.0E-12
sp|P47624|OBG_MYCGE GTPase Obg OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=obg PE=3 SV=1 120 201 4.0E-12
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 120 241 4.0E-12
sp|Q8EPQ0|OBG_OCEIH GTPase Obg OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=obg PE=3 SV=1 120 241 4.0E-12
sp|B7HE73|OBG_BACC4 GTPase Obg OS=Bacillus cereus (strain B4264) GN=obg PE=3 SV=1 120 241 4.0E-12
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 120 244 4.0E-12
sp|Q1R6F4|OBG_ECOUT GTPase Obg OS=Escherichia coli (strain UTI89 / UPEC) GN=obg PE=3 SV=1 121 241 4.0E-12
sp|B9IZ16|OBG_BACCQ GTPase Obg OS=Bacillus cereus (strain Q1) GN=obg PE=3 SV=1 120 241 4.0E-12
sp|B5XSV8|OBG_KLEP3 GTPase Obg OS=Klebsiella pneumoniae (strain 342) GN=obg PE=3 SV=1 120 241 4.0E-12
sp|Q817U6|OBG_BACCR GTPase Obg OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=obg PE=3 SV=1 120 241 4.0E-12
sp|Q72ZY5|OBG_BACC1 GTPase Obg OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=obg PE=3 SV=1 120 241 4.0E-12
sp|B7HQJ8|OBG_BACC7 GTPase Obg OS=Bacillus cereus (strain AH187) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|Q8FD82|OBG_ECOL6 GTPase Obg OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q0TCS7|OBG_ECOL5 GTPase Obg OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|A1AG86|OBG_ECOK1 GTPase Obg OS=Escherichia coli O1:K1 / APEC GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B5YS72|OBG_ECO5E GTPase Obg OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q8X9K7|OBG_ECO57 GTPase Obg OS=Escherichia coli O157:H7 GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7MBV2|OBG_ECO45 GTPase Obg OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|A6TEK2|OBG_KLEP7 GTPase Obg OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 86 241 5.0E-12
sp|B7NKQ0|OBG_ECO7I GTPase Obg OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|P42641|OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) GN=obgE PE=1 SV=1 121 241 5.0E-12
sp|B1XHF9|OBG_ECODH GTPase Obg OS=Escherichia coli (strain K12 / DH10B) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q6HD85|OBG_BACHK GTPase Obg OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|Q634A3|OBG_BACCZ GTPase Obg OS=Bacillus cereus (strain ZK / E33L) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|C1ETN7|OBG_BACC3 GTPase Obg OS=Bacillus cereus (strain 03BB102) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|A0RJ47|OBG_BACAH GTPase Obg OS=Bacillus thuringiensis (strain Al Hakam) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|Q32BF0|OBG_SHIDS GTPase Obg OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 120 224 5.0E-12
sp|Q3YX58|OBG_SHISS GTPase Obg OS=Shigella sonnei (strain Ss046) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q83Q14|OBG_SHIFL GTPase Obg OS=Shigella flexneri GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q0T0A1|OBG_SHIF8 GTPase Obg OS=Shigella flexneri serotype 5b (strain 8401) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|Q31W60|OBG_SHIBS GTPase Obg OS=Shigella boydii serotype 4 (strain Sb227) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B2U1Z4|OBG_SHIB3 GTPase Obg OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7LR50|OBG_ESCF3 GTPase Obg OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B1LFT3|OBG_ECOSM GTPase Obg OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B6I1Q6|OBG_ECOSE GTPase Obg OS=Escherichia coli (strain SE11) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7NDG7|OBG_ECOLU GTPase Obg OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B1IQU0|OBG_ECOLC GTPase Obg OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|A8A4Z8|OBG_ECOHS GTPase Obg OS=Escherichia coli O9:H4 (strain HS) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7M089|OBG_ECO8A GTPase Obg OS=Escherichia coli O8 (strain IAI1) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7N0W5|OBG_ECO81 GTPase Obg OS=Escherichia coli O81 (strain ED1a) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7LHP6|OBG_ECO55 GTPase Obg OS=Escherichia coli (strain 55989 / EAEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7UJ76|OBG_ECO27 GTPase Obg OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|A7ZS79|OBG_ECO24 GTPase Obg OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=obg PE=3 SV=1 121 241 5.0E-12
sp|B7JQ26|OBG_BACC0 GTPase Obg OS=Bacillus cereus (strain AH820) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|Q81LF0|OBG_BACAN GTPase Obg OS=Bacillus anthracis GN=obg PE=3 SV=1 120 241 5.0E-12
sp|Q3B6H6|OBG_CHLL7 GTPase Obg OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=obg PE=3 SV=1 120 252 5.0E-12
sp|P75215|OBG_MYCPN GTPase Obg OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=obg PE=3 SV=1 120 208 5.0E-12
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 120 241 5.0E-12
sp|B2IE44|OBG_BEII9 GTPase Obg OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=obg PE=3 SV=1 120 241 6.0E-12
sp|B0UMS4|OBG_METS4 GTPase Obg OS=Methylobacterium sp. (strain 4-46) GN=obg PE=3 SV=1 38 241 6.0E-12
sp|B4S5P1|OBG_PROA2 GTPase Obg OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=obg PE=3 SV=1 105 241 6.0E-12
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 120 241 6.0E-12
sp|Q03F34|OBG_PEDPA GTPase Obg OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=obg PE=3 SV=1 120 224 6.0E-12
sp|Q5NR23|OBG_ZYMMO GTPase Obg OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=obg PE=3 SV=1 120 241 7.0E-12
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 120 241 7.0E-12
sp|A5VD74|OBG_SPHWW GTPase Obg OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=obg PE=3 SV=1 120 241 7.0E-12
sp|B1ZZ37|OBG_OPITP GTPase Obg OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=obg PE=3 SV=1 120 241 7.0E-12
sp|A7MJF1|OBG_CROS8 GTPase Obg OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=obg PE=3 SV=1 120 241 7.0E-12
sp|Q2NIK0|OBG_AYWBP GTPase Obg OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=obg PE=3 SV=1 120 224 8.0E-12
sp|Q1B629|OBG_MYCSS GTPase Obg OS=Mycobacterium sp. (strain MCS) GN=obg PE=3 SV=1 120 224 8.0E-12
sp|A1UJ07|OBG_MYCSK GTPase Obg OS=Mycobacterium sp. (strain KMS) GN=obg PE=3 SV=1 120 224 8.0E-12
sp|A3Q2F3|OBG_MYCSJ GTPase Obg OS=Mycobacterium sp. (strain JLS) GN=obg PE=3 SV=1 120 224 8.0E-12
sp|A8LK09|OBG_DINSH GTPase Obg OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=obg PE=3 SV=1 120 241 8.0E-12
sp|Q5Z041|OBG_NOCFA GTPase Obg OS=Nocardia farcinica (strain IFM 10152) GN=obg PE=3 SV=1 120 224 8.0E-12
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 120 329 8.0E-12
sp|B1N057|OBG_LEUCK GTPase Obg OS=Leuconostoc citreum (strain KM20) GN=obg PE=3 SV=2 120 241 8.0E-12
sp|A8FRU4|OBG_SHESH GTPase Obg OS=Shewanella sediminis (strain HAW-EB3) GN=obg PE=3 SV=1 120 241 9.0E-12
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 120 329 9.0E-12
sp|Q64XA5|OBG_BACFR GTPase Obg OS=Bacteroides fragilis (strain YCH46) GN=obg PE=3 SV=1 120 224 1.0E-11
sp|Q5LGG9|OBG_BACFN GTPase Obg OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=obg PE=3 SV=2 120 224 1.0E-11
sp|A8AQ74|OBG_CITK8 GTPase Obg OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 120 329 1.0E-11
sp|P44915|OBG_HAEIN GTPase Obg OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=obg PE=3 SV=1 121 241 1.0E-11
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|Q5RDW1|MTG2_PONAB Mitochondrial ribosome-associated GTPase 2 OS=Pongo abelii GN=MTG2 PE=2 SV=1 120 241 1.0E-11
sp|B2HMG1|OBG_MYCMM GTPase Obg OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=obg PE=3 SV=1 120 224 1.0E-11
sp|Q0SR54|OBG_CLOPS GTPase Obg OS=Clostridium perfringens (strain SM101 / Type A) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|Q8XIJ2|OBG_CLOPE GTPase Obg OS=Clostridium perfringens (strain 13 / Type A) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|Q0TNI5|OBG_CLOP1 GTPase Obg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|Q8RHS8|OBG_FUSNN GTPase Obg OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=obg PE=3 SV=1 105 207 1.0E-11
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 120 232 1.0E-11
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 120 301 1.0E-11
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|Q9H4K7|MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens GN=MTG2 PE=1 SV=1 120 241 1.0E-11
sp|Q03YT6|OBG_LEUMM GTPase Obg OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=obg PE=3 SV=1 120 265 1.0E-11
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 120 234 1.0E-11
sp|B5RQB8|OBG_BORRA GTPase Obg OS=Borrelia recurrentis (strain A1) GN=obg PE=3 SV=1 120 287 1.0E-11
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 120 224 1.0E-11
sp|B0BRJ9|OBG_ACTPJ GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=obg PE=3 SV=1 121 244 1.0E-11
sp|B3GZN0|OBG_ACTP7 GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=obg PE=3 SV=1 121 244 1.0E-11
sp|A5WFV1|OBG_PSYWF GTPase Obg OS=Psychrobacter sp. (strain PRwf-1) GN=obg PE=3 SV=1 86 242 1.0E-11
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 120 291 1.0E-11
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 120 221 1.0E-11
sp|Q4QM31|OBG_HAEI8 GTPase Obg OS=Haemophilus influenzae (strain 86-028NP) GN=obg PE=3 SV=1 121 241 1.0E-11
sp|P95758|OBG_STRGR GTPase Obg OS=Streptomyces griseus GN=obg PE=1 SV=1 120 241 1.0E-11
sp|B1VXD8|OBG_STRGG GTPase Obg OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=obg PE=3 SV=1 120 241 1.0E-11
sp|A3MYB2|OBG_ACTP2 GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=obg PE=3 SV=1 121 244 1.0E-11
sp|Q892N8|OBG_CLOTE GTPase Obg OS=Clostridium tetani (strain Massachusetts / E88) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 120 227 2.0E-11
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 86 228 2.0E-11
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 86 228 2.0E-11
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 120 295 2.0E-11
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 120 296 2.0E-11
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 120 221 2.0E-11
sp|B2UQ30|OBG_AKKM8 GTPase Obg OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=obg PE=3 SV=2 120 241 2.0E-11
sp|B9KJ19|OBG2_ANAMF GTPase Obg 2 OS=Anaplasma marginale (strain Florida) GN=obg2 PE=3 SV=1 120 210 2.0E-11
sp|Q5PAA7|OBG2_ANAMM GTPase Obg 2 OS=Anaplasma marginale (strain St. Maries) GN=obg2 PE=3 SV=1 120 210 2.0E-11
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 120 241 2.0E-11
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 120 241 2.0E-11
sp|A8M0Y9|OBG_SALAI GTPase Obg OS=Salinispora arenicola (strain CNS-205) GN=obg PE=3 SV=1 120 225 2.0E-11
sp|A0R149|OBG_MYCS2 GTPase Obg OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=obg PE=3 SV=1 19 224 2.0E-11
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 120 224 2.0E-11
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 120 244 2.0E-11
sp|Q165Y6|OBG_ROSDO GTPase Obg OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|B1X0M2|OBG_CYAA5 GTPase Obg OS=Cyanothece sp. (strain ATCC 51142) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 120 241 2.0E-11
sp|Q1QA43|OBG_PSYCK GTPase Obg OS=Psychrobacter cryohalolentis (strain K5) GN=obg PE=3 SV=1 120 242 2.0E-11
sp|B9KIJ7|OBG1_ANAMF GTPase Obg 1 OS=Anaplasma marginale (strain Florida) GN=obg1 PE=3 SV=1 120 210 2.0E-11
sp|B8HU67|OBG_CYAP4 GTPase Obg OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|B9MRB8|OBG_CALBD GTPase Obg OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|A4XAG1|OBG_SALTO GTPase Obg OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|A0PU15|OBG_MYCUA GTPase Obg OS=Mycobacterium ulcerans (strain Agy99) GN=obg PE=3 SV=1 120 224 2.0E-11
sp|A4XJS8|OBG_CALS8 GTPase Obg OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=obg PE=3 SV=2 120 241 2.0E-11
sp|Q0AHG5|OBG_NITEC GTPase Obg OS=Nitrosomonas eutropha (strain C91) GN=obg PE=3 SV=1 120 241 2.0E-11
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 120 241 3.0E-11
sp|A9FJF8|OBG_SORC5 GTPase Obg OS=Sorangium cellulosum (strain So ce56) GN=obg PE=3 SV=1 120 241 3.0E-11
sp|A0M5C6|OBG_GRAFK GTPase Obg OS=Gramella forsetii (strain KT0803) GN=obg PE=3 SV=1 120 204 3.0E-11
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 120 241 3.0E-11
sp|B3EP74|OBG_CHLPB GTPase Obg OS=Chlorobium phaeobacteroides (strain BS1) GN=obg PE=3 SV=1 86 241 3.0E-11
sp|Q5PAS5|OBG1_ANAMM GTPase Obg 1 OS=Anaplasma marginale (strain St. Maries) GN=obg1 PE=3 SV=1 120 210 3.0E-11
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 120 241 3.0E-11
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 120 241 3.0E-11
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 120 221 3.0E-11
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 120 241 3.0E-11
sp|Q5E871|OBG_VIBF1 GTPase Obg OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=obg PE=3 SV=1 121 241 3.0E-11
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 121 241 3.0E-11
sp|B2VGT5|OBG_ERWT9 GTPase Obg OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=obg PE=3 SV=1 120 241 3.0E-11
sp|Q04B11|OBG_LACDB GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=obg PE=3 SV=1 83 192 3.0E-11
sp|Q1GAM3|OBG_LACDA GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=obg PE=3 SV=1 83 192 3.0E-11
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 120 221 3.0E-11
sp|Q2RKZ8|OBG_MOOTA GTPase Obg OS=Moorella thermoacetica (strain ATCC 39073) GN=obg PE=3 SV=1 120 244 3.0E-11
sp|A9BDI4|OBG_PROM4 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9211) GN=obg PE=3 SV=1 121 241 3.0E-11
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 120 241 3.0E-11
sp|B1I5V8|OBG_DESAP GTPase Obg OS=Desulforudis audaxviator (strain MP104C) GN=obg PE=3 SV=1 121 241 3.0E-11
sp|B4RZH3|OBG_ALTMD GTPase Obg OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=obg1 PE=3 SV=1 120 241 3.0E-11
sp|Q3MHG6|GTPBA_BOVIN GTP-binding protein 10 OS=Bos taurus GN=GTPBP10 PE=2 SV=1 86 204 4.0E-11
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 120 241 4.0E-11
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 120 241 4.0E-11
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 120 241 4.0E-11
sp|Q5FUL2|OBG_GLUOX GTPase Obg OS=Gluconobacter oxydans (strain 621H) GN=obg PE=3 SV=2 120 241 4.0E-11
sp|B1VGL9|OBG_CORU7 GTPase Obg OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=obg PE=3 SV=1 120 224 4.0E-11
sp|B5FGF9|OBG_VIBFM GTPase Obg OS=Vibrio fischeri (strain MJ11) GN=obg PE=3 SV=1 121 241 4.0E-11
sp|A8G8Z4|OBG_SERP5 GTPase Obg OS=Serratia proteamaculans (strain 568) GN=obg PE=3 SV=1 121 241 4.0E-11
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 120 271 5.0E-11
sp|B5RMX3|OBG_BORDL GTPase Obg OS=Borrelia duttonii (strain Ly) GN=obg PE=3 SV=1 120 287 5.0E-11
sp|B1MMY5|OBG_MYCA9 GTPase Obg OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=obg PE=3 SV=1 19 221 5.0E-11
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 120 225 5.0E-11
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 120 225 5.0E-11
sp|Q602A7|OBG_MYCH2 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 232) GN=obg PE=3 SV=1 114 224 5.0E-11
sp|Q9Z808|OBG_CHLPN GTPase Obg OS=Chlamydia pneumoniae GN=obg PE=3 SV=1 120 241 5.0E-11
sp|Q9ZMD3|OBG_HELPJ GTPase Obg OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=obg PE=3 SV=1 120 241 5.0E-11
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 120 241 5.0E-11
sp|Q2S3C0|OBG_SALRD GTPase Obg OS=Salinibacter ruber (strain DSM 13855 / M31) GN=obg PE=3 SV=1 120 241 5.0E-11
sp|Q0BZ39|OBG_HYPNA GTPase Obg OS=Hyphomonas neptunium (strain ATCC 15444) GN=obg PE=3 SV=1 120 241 5.0E-11
sp|Q4AAV4|OBG_MYCHJ GTPase Obg OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=obg PE=3 SV=1 114 224 5.0E-11
sp|Q4A8X1|OBG_MYCH7 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 7448) GN=obg PE=3 SV=1 114 224 6.0E-11
sp|Q5N4J6|OBG_SYNP6 GTPase Obg OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=obg PE=3 SV=1 120 241 6.0E-11
sp|Q31PN0|OBG_SYNE7 GTPase Obg OS=Synechococcus elongatus (strain PCC 7942) GN=obg PE=3 SV=1 120 241 6.0E-11
sp|Q5M8V6|GTPBA_XENTR GTP-binding protein 10 OS=Xenopus tropicalis GN=gtpbp10 PE=2 SV=1 120 204 6.0E-11
sp|B6YRA6|OBG_AZOPC GTPase Obg OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=obg PE=3 SV=1 120 224 6.0E-11
sp|B1ZL15|OBG_METPB GTPase Obg OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=obg PE=3 SV=1 120 241 6.0E-11
sp|A4T2J4|OBG_MYCGI GTPase Obg OS=Mycobacterium gilvum (strain PYR-GCK) GN=obg PE=3 SV=1 120 224 6.0E-11
sp|Q73XP5|OBG_MYCPA GTPase Obg OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=obg PE=3 SV=1 120 224 6.0E-11
sp|A0QDH0|OBG_MYCA1 GTPase Obg OS=Mycobacterium avium (strain 104) GN=obg PE=3 SV=1 120 224 6.0E-11
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 120 241 6.0E-11
sp|A1TC21|OBG_MYCVP GTPase Obg OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=obg PE=3 SV=1 120 224 7.0E-11
sp|Q6YRC6|OBG_ONYPE GTPase Obg OS=Onion yellows phytoplasma (strain OY-M) GN=obg PE=3 SV=1 120 240 7.0E-11
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 120 241 7.0E-11
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 120 241 7.0E-11
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 120 224 7.0E-11
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 120 224 7.0E-11
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 120 241 7.0E-11
sp|A9VYM4|OBG_METEP GTPase Obg OS=Methylobacterium extorquens (strain PA1) GN=obg PE=3 SV=1 120 241 7.0E-11
sp|B7KSH0|OBG_METC4 GTPase Obg OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=obg PE=3 SV=1 120 241 7.0E-11
sp|Q89X89|OBG_BRADU GTPase Obg OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=obg PE=3 SV=1 120 225 7.0E-11
sp|Q47VL4|OBG_COLP3 GTPase Obg OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=obg PE=3 SV=1 129 241 7.0E-11
sp|Q11Z03|OBG_CYTH3 GTPase Obg OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=obg PE=3 SV=1 120 240 8.0E-11
sp|Q8Z3H1|OBG_SALTI GTPase Obg OS=Salmonella typhi GN=obg PE=3 SV=1 121 241 8.0E-11
sp|Q8L7L0|OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana GN=OBGL PE=2 SV=1 120 241 8.0E-11
sp|Q8ZLS5|OBG_SALTY GTPase Obg OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=obg PE=1 SV=1 121 241 8.0E-11
sp|B4TWF3|OBG_SALSV GTPase Obg OS=Salmonella schwarzengrund (strain CVM19633) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B5BGK7|OBG_SALPK GTPase Obg OS=Salmonella paratyphi A (strain AKU_12601) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|C0PZJ5|OBG_SALPC GTPase Obg OS=Salmonella paratyphi C (strain RKS4594) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|A9N750|OBG_SALPB GTPase Obg OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|Q5PLB7|OBG_SALPA GTPase Obg OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B4T714|OBG_SALNS GTPase Obg OS=Salmonella newport (strain SL254) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B4TJ21|OBG_SALHS GTPase Obg OS=Salmonella heidelberg (strain SL476) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B5R0H4|OBG_SALEP GTPase Obg OS=Salmonella enteritidis PT4 (strain P125109) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B5FIN3|OBG_SALDC GTPase Obg OS=Salmonella dublin (strain CT_02021853) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|Q57JG7|OBG_SALCH GTPase Obg OS=Salmonella choleraesuis (strain SC-B67) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B5F6V2|OBG_SALA4 GTPase Obg OS=Salmonella agona (strain SL483) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|Q8K013|GTPBA_MOUSE GTP-binding protein 10 OS=Mus musculus GN=Gtpbp10 PE=2 SV=1 120 204 8.0E-11
sp|A9MP23|OBG_SALAR GTPase Obg OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 120 224 8.0E-11
sp|B1JMI3|OBG_YERPY GTPase Obg OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|Q66F73|OBG_YERPS GTPase Obg OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|A4TRJ6|OBG_YERPP GTPase Obg OS=Yersinia pestis (strain Pestoides F) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|Q1CEK0|OBG_YERPN GTPase Obg OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|A9R591|OBG_YERPG GTPase Obg OS=Yersinia pestis bv. Antiqua (strain Angola) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|Q7CKJ6|OBG_YERPE GTPase Obg OS=Yersinia pestis GN=obg PE=3 SV=1 121 344 8.0E-11
sp|B2K2P2|OBG_YERPB GTPase Obg OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|Q1CBZ4|OBG_YERPA GTPase Obg OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|A7FMT5|OBG_YERP3 GTPase Obg OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=obg PE=3 SV=1 121 344 8.0E-11
sp|B7VID5|OBG_VIBTL GTPase Obg OS=Vibrio tasmaniensis (strain LGP32) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|B5REP9|OBG_SALG2 GTPase Obg OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=obg PE=3 SV=1 121 241 8.0E-11
sp|A4J7I9|OBG_DESRM GTPase Obg OS=Desulfotomaculum reducens (strain MI-1) GN=obg PE=3 SV=1 120 241 8.0E-11
sp|A1JIV6|OBG_YERE8 GTPase Obg OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=obg PE=3 SV=1 121 344 9.0E-11
sp|A5FMX0|OBG_FLAJ1 GTPase Obg OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=obg PE=3 SV=1 120 204 9.0E-11
sp|Q17Y93|OBG_HELAH GTPase Obg OS=Helicobacter acinonychis (strain Sheeba) GN=obg PE=3 SV=1 120 241 9.0E-11
sp|B8EQH4|OBG_METSB GTPase Obg OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=obg PE=3 SV=1 120 241 9.0E-11
sp|A9L430|OBG_SHEB9 GTPase Obg OS=Shewanella baltica (strain OS195) GN=obg PE=3 SV=1 127 241 9.0E-11
sp|A6WK51|OBG_SHEB8 GTPase Obg OS=Shewanella baltica (strain OS185) GN=obg PE=3 SV=1 127 241 9.0E-11
sp|A3D180|OBG_SHEB5 GTPase Obg OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=obg PE=3 SV=1 127 241 9.0E-11
sp|B8EC04|OBG_SHEB2 GTPase Obg OS=Shewanella baltica (strain OS223) GN=obg PE=3 SV=1 127 241 9.0E-11
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 120 241 9.0E-11
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 120 241 9.0E-11
sp|Q4FRK6|OBG_PSYA2 GTPase Obg OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=obg PE=3 SV=1 120 242 9.0E-11
sp|A7HT67|OBG_PARL1 GTPase Obg OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=obg PE=3 SV=1 120 267 9.0E-11
sp|B6EL43|OBG_ALISL GTPase Obg OS=Aliivibrio salmonicida (strain LFI1238) GN=obg PE=3 SV=1 42 241 1.0E-10
sp|Q6MTG9|OBG_MYCMS GTPase Obg OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=obg PE=3 SV=1 120 261 1.0E-10
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 120 287 1.0E-10
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|Q1AVU3|OBG_RUBXD GTPase Obg OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|Q4FP46|OBG_PELUB GTPase Obg OS=Pelagibacter ubique (strain HTCC1062) GN=obg PE=3 SV=1 120 207 1.0E-10
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 120 241 1.0E-10
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 120 221 1.0E-10
sp|Q3ZAJ2|OBG_DEHM1 GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|Q12K23|OBG_SHEDO GTPase Obg OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=obg PE=3 SV=1 127 241 1.0E-10
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|B2USD4|OBG_HELPS GTPase Obg OS=Helicobacter pylori (strain Shi470) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|Q3KLT5|OBG_CHLTA GTPase Obg OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=obg PE=3 SV=1 120 242 1.0E-10
sp|O84423|OBG_CHLTR GTPase Obg OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=obg PE=3 SV=1 120 242 1.0E-10
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|C0QX49|OBG_BRAHW GTPase Obg OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 120 204 1.0E-10
sp|A8H0U4|OBG_SHEPA GTPase Obg OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=obg PE=3 SV=1 127 241 1.0E-10
sp|Q6E0U3|OBG_VIBHA GTPase Obg/CgtA OS=Vibrio harveyi GN=cgtA PE=1 SV=1 121 241 1.0E-10
sp|A7N0G2|OBG_VIBCB GTPase Obg OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=obg PE=3 SV=1 121 241 1.0E-10
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|B0TUI2|OBG_SHEHH GTPase Obg OS=Shewanella halifaxensis (strain HAW-EB4) GN=obg PE=3 SV=1 127 241 1.0E-10
sp|Q7VDW9|OBG_PROMA GTPase Obg OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=obg PE=3 SV=1 123 241 1.0E-10
sp|O25074|OBG_HELPY GTPase Obg OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=obg PE=3 SV=1 120 241 1.0E-10
sp|Q87SU2|OBG_VIBPA GTPase Obg OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=obg PE=3 SV=1 121 241 2.0E-10
sp|B5ZA69|OBG_HELPG GTPase Obg OS=Helicobacter pylori (strain G27) GN=obg PE=3 SV=1 120 241 2.0E-10
sp|Q2J3J8|OBG_RHOP2 GTPase Obg OS=Rhodopseudomonas palustris (strain HaA2) GN=obg PE=3 SV=1 120 224 2.0E-10
sp|B6J9K2|OBG_COXB1 GTPase Obg OS=Coxiella burnetii (strain CbuK_Q154) GN=obg PE=3 SV=1 121 241 2.0E-10
sp|Q83ED8|OBG_COXBU GTPase Obg OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=obg PE=3 SV=1 121 241 2.0E-10
sp|A9KEJ7|OBG_COXBN GTPase Obg OS=Coxiella burnetii (strain Dugway 5J108-111) GN=obg PE=3 SV=1 121 241 2.0E-10
sp|B6J1S8|OBG_COXB2 GTPase Obg OS=Coxiella burnetii (strain CbuG_Q212) GN=obg PE=3 SV=1 121 241 2.0E-10
sp|A9NBL5|OBG_COXBR GTPase Obg OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=obg PE=3 SV=1 121 241 2.0E-10
sp|P9WMT1|OBG_MYCTU GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=obg PE=1 SV=1 120 224 2.0E-10
sp|A5U5D6|OBG_MYCTA GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=obg PE=3 SV=1 120 224 2.0E-10
sp|A1KLD6|OBG_MYCBP GTPase Obg OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=obg PE=3 SV=1 120 224 2.0E-10
sp|Q7TYK5|OBG_MYCBO GTPase Obg OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=obg PE=3 SV=1 120 224 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6468
MLKAVLKDMYRVNRELGPHVRLHHHFHGHLNRPHLSPQSLRKNSGSRGSVKRRPGITMSTTVEKIKEIEAEMART
QKNKATSFHLGQLKAKLAKLKRELLTPSGGGGGGGAGFDVARTGVASIGFIGFPSVGKSTLMSRLTGQHSEAAAY
EFTTLTSVPGQVIYNGAPLQIIDLPGIIEGAKDGRGRGRQVIAVAKTCHLIFIILDVNKPLTDKRVIESELEGFG
IRINKEPPNITFKKKDKGGLNITSTVPLSHIDNDEIRAVMSEYRINSADITIRCDATVDDLIDVLEARSRSYIPV
VYCLNKIDSISIEELDLLYRIPNAVPISSEHGWNIDELMEAMWDKLSLRRVYTKPKGKQPDYSAPVVLRASRCTV
EDFCNAIHRSIVEQFKTAIVYGKSVKHQPQRVGLAHELDDEDVVTIVKR*
Coding >Ophun1|6468
ATGCTGAAGGCTGTGCTGAAAGACATGTACCGCGTTAACAGAGAACTGGGCCCGCACGTCCGCTTACATCACCAC
TTCCACGGGCATCTCAATCGACCTCACCTTTCCCCACAGAGCCTCAGGAAGAATTCGGGATCGCGAGGCAGCGTC
AAGCGCCGGCCAGGTATCACCATGTCGACCACGGTGGAAAAGATCAAGGAGATCGAGGCCGAGATGGCCCGGACG
CAAAAGAACAAGGCGACGTCGTTCCATCTCGGCCAGCTCAAGGCCAAGCTGGCCAAGCTGAAGCGGGAGCTGCTC
ACGCCCAGCGGCGGCGGCGGCGGCGGCGGAGCGGGCTTCGACGTTGCGAGGACGGGCGTGGCCAGCATCGGCTTC
ATCGGCTTCCCGTCGGTGGGGAAGAGCACGCTGATGAGCAGGCTGACGGGGCAGCACTCGGAGGCGGCGGCGTAC
GAGTTCACGACGTTGACGAGCGTGCCGGGGCAGGTGATTTACAACGGCGCGCCGCTGCAGATCATCGACTTGCCC
GGAATCATCGAGGGTGCCAAGGATGGCCGCGGTCGGGGTCGGCAGGTTATCGCGGTGGCCAAGACGTGTCACCTC
ATCTTCATCATCCTCGACGTCAACAAGCCGCTGACGGACAAGCGCGTCATCGAGTCGGAGCTCGAGGGCTTCGGC
ATCCGCATCAACAAGGAGCCGCCCAACATTACGTTCAAGAAGAAGGACAAGGGTGGACTCAACATCACGAGCACG
GTGCCGCTCAGCCATATTGACAACGACGAGATCAGGGCCGTCATGAGCGAGTATCGCATCAACTCGGCCGACATA
ACCATCCGCTGCGACGCGACCGTCGACGACCTGATTGACGTGCTCGAGGCTAGGAGTCGCAGTTACATCCCCGTC
GTGTACTGTCTCAACAAGATTGACTCGATCAGCATCGAGGAGCTGGATCTGCTCTACCGGATCCCCAACGCGGTG
CCCATCAGCTCCGAGCACGGGTGGAACATTGACGAACTCATGGAGGCCATGTGGGACAAATTGAGCCTGAGACGC
GTCTATACAAAGCCCAAGGGGAAACAGCCTGATTACTCGGCCCCTGTCGTACTGCGGGCTTCTAGGTGCACCGTC
GAAGACTTTTGTAACGCGATCCATCGCAGCATCGTGGAACAGTTCAAGACGGCCATTGTCTACGGCAAGTCGGTG
AAGCATCAGCCCCAAAGGGTGGGCTTGGCTCACGAGTTGGACGATGAGGATGTTGTGACCATTGTCAAGCGATGA
Transcript >Ophun1|6468
ATGCTGAAGGCTGTGCTGAAAGACATGTACCGCGTTAACAGAGAACTGGGCCCGCACGTCCGCTTACATCACCAC
TTCCACGGGCATCTCAATCGACCTCACCTTTCCCCACAGAGCCTCAGGAAGAATTCGGGATCGCGAGGCAGCGTC
AAGCGCCGGCCAGGTATCACCATGTCGACCACGGTGGAAAAGATCAAGGAGATCGAGGCCGAGATGGCCCGGACG
CAAAAGAACAAGGCGACGTCGTTCCATCTCGGCCAGCTCAAGGCCAAGCTGGCCAAGCTGAAGCGGGAGCTGCTC
ACGCCCAGCGGCGGCGGCGGCGGCGGCGGAGCGGGCTTCGACGTTGCGAGGACGGGCGTGGCCAGCATCGGCTTC
ATCGGCTTCCCGTCGGTGGGGAAGAGCACGCTGATGAGCAGGCTGACGGGGCAGCACTCGGAGGCGGCGGCGTAC
GAGTTCACGACGTTGACGAGCGTGCCGGGGCAGGTGATTTACAACGGCGCGCCGCTGCAGATCATCGACTTGCCC
GGAATCATCGAGGGTGCCAAGGATGGCCGCGGTCGGGGTCGGCAGGTTATCGCGGTGGCCAAGACGTGTCACCTC
ATCTTCATCATCCTCGACGTCAACAAGCCGCTGACGGACAAGCGCGTCATCGAGTCGGAGCTCGAGGGCTTCGGC
ATCCGCATCAACAAGGAGCCGCCCAACATTACGTTCAAGAAGAAGGACAAGGGTGGACTCAACATCACGAGCACG
GTGCCGCTCAGCCATATTGACAACGACGAGATCAGGGCCGTCATGAGCGAGTATCGCATCAACTCGGCCGACATA
ACCATCCGCTGCGACGCGACCGTCGACGACCTGATTGACGTGCTCGAGGCTAGGAGTCGCAGTTACATCCCCGTC
GTGTACTGTCTCAACAAGATTGACTCGATCAGCATCGAGGAGCTGGATCTGCTCTACCGGATCCCCAACGCGGTG
CCCATCAGCTCCGAGCACGGGTGGAACATTGACGAACTCATGGAGGCCATGTGGGACAAATTGAGCCTGAGACGC
GTCTATACAAAGCCCAAGGGGAAACAGCCTGATTACTCGGCCCCTGTCGTACTGCGGGCTTCTAGGTGCACCGTC
GAAGACTTTTGTAACGCGATCCATCGCAGCATCGTGGAACAGTTCAAGACGGCCATTGTCTACGGCAAGTCGGTG
AAGCATCAGCCCCAAAGGGTGGGCTTGGCTCACGAGTTGGACGATGAGGATGTTGTGACCATTGTCAAGCGATGA
Gene >Ophun1|6468
ATGCTGAAGGCTGTGCTGAAAGACATGTACCGCGTTAACAGAGAACTGGGCCCGCACGTCCGCTTACATCACCAC
TTCCACGGGCATCTCAATCGACCTCACCTTTCCCCACAGAGCCTCAGGAAGAATTCGGGATCGCGAGGCAGCGTC
AAGCGCCGGCCAGGTATCACCATGTCGACCACGGTGGAAAAGGTGAGTCCTCCCGGTAGAAGTGTTCGTCCGGTA
TGCTGACACAGACGCAGATCAAGGAGATCGAGGCCGAGGTGAGCAGAGGCCGGTTCGGCAGACGAGGAGGGCCGG
GGACTGACGTGCCAACCCCAGATGGCCCGGACGCAAAAGAACAAGGCGACGTCGTTCCATCTCGGCCAGCTCAAG
GCCAAGCTGGCCAAGCTGAAGCGGGAGCTGCTCACGCCCAGCGGCGGCGGCGGCGGCGGCGGAGCGGGCTTCGAC
GTTGCGAGGACGGGCGTGGCCAGCATCGGCTTCATCGGCTTCCCGTCGGTGGGGAAGAGCACGCTGATGAGCAGG
CTGACGGGGCAGCACTCGGAGGCGGCGGCGTACGAGTTCACGACGTTGACGAGCGTGCCGGGGCAGGTGATTTAC
AACGGCGCGCCGCTGCAGATCATCGACTTGCCCGGAATCATCGAGGGTGCCAAGGATGGCCGCGGTCGGGGTCGG
CAGGTTATCGCGGTGGCCAAGACGTGTCACCTCATCTTCATCATCCTCGACGTCAACAAGCCGCTGACGGACAAG
CGCGTCATCGAGTCGGAGCTCGAGGGCTTCGGCATCCGCATCAACAAGGAGCCGCCCAACATTACGTTCAAGAAG
AAGGACAAGGGTGGACTCAACATCACGAGCACGGTGCCGCTCAGCCATATTGACAACGACGAGATCAGGGCCGTC
ATGAGCGAGTATCGCATCAACTCGGCCGACATAACCATCCGCTGCGACGCGACCGTCGACGACCTGATTGACGTG
CTCGAGGCTAGGAGTCGCAGTTACATCCCCGTCGTGTACTGTCTCAACAAGATTGACTCGATCAGCATCGAGGAG
CTGGATCTGCTCTACCGGATCCCCAACGCGGTGCCCATCAGCTCCGAGCACGGGTGGAACATTGACGAACTCATG
GAGGCCATGTGGGACAAATTGAGCCTGAGACGCGTCTATACAAAGCCCAAGGGGAAACAGCCTGATTACTCGGCC
CCTGTCGTACTGCGGGCTTCTAGGTGCACCGTCGAAGACTTTGTGGGTTTTTTCTATGGTGCCTCGGTTGGCACG
TTTCTGTGGCTGACGCGGCAGGCAGTGTAACGCGATCCATCGCAGCATCGTGGAACAGTTCAAGACGGCCATTGT
CTACGGCAAGTCGGTGAAGCATCAGCCCCAAAGGGTGGGCTTGGCTCACGAGTTGGACGATGAGGATGTTGGTGA
GTGTTGTTGTTTTTGGTTTCCTCCTCCGGAGTCGTTGCCACTTGCAGCGAACCTATCACTCGAGGCCGGGGCGCT
GCGGAGATGAAGCCCTTGCCACCCCCCCTGTGTTCAGCTGGCCGGACGGCGGCGGCGCTAACGCTTAGCAGTGAC
CATTGTCAAGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail