Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6467
Gene name
LocationContig_706:6180..9010
Strand+
Gene length (bp)2830
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08639 SLD3 DNA replication regulator SLD3 2.2E-148 271 799

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7013
Ophiocordyceps australis map64 (Brazil) OphauB2|2655
Ophiocordyceps camponoti-floridani Ophcf2|07130
Ophiocordyceps camponoti-rufipedis Ophun1|6467 (this protein)
Ophiocordyceps kimflemingae Ophio5|159
Ophiocordyceps subramaniannii Hirsu2|1510

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6467
MSGTPAGGTDASRTRAILTPSSDGSDDGKRRADAGAMEELLRPSVAVKVGESNPTCPRLLLPLMLLPREHLSLAS
IDFGASDRDMPSSRLFESRVKMLDLESRFGAPTSVLVARNEARGTVHVLERQGSNEGLYVMCQLGSWVDLAALAG
KATAVAWERLRALTSQHRPGGKGNVPLPAPPLFKESGRKRAAMEAVQSLVRKRVRSRSISTANDAGRDVLAPVSG
NQARLQTPGCTTKPEDAENVLADIAPALDLDGMDSTAQPPATAEAIFDGIRSQYSEALYKSMGSLAYFVKGPLSR
ARSAFLIDLESSLDMSDLIDFLKSLILTTVQIDTKYRDTIPDLIAKVGFDGSDENSSKRKRRPRKMKIGKSGLFP
HEDESIRKWWASKQQQQPGDNQSSSSTATAQLKSHVSLLRTRETQLQMIIALEILALEPLKAAEDVLPRLPETEP
SGEPTTPVPAPRKRSRLNLPLLIDVHADRLTIWQSIASDEQLVLGESQVSRQPDGQLQPRTSAEPLKDFCVDIIV
PFFSSRLPELCDGINRKLGGPLLLSPPKSKPSRTAPKKREQKPGTVAKRPTPVRSQRTLQRALSAEQQHRRSLSR
GPSSAIAQLRSTTTASLVNVKREVSDPASARGLKEAPRLAPAWKRPPLSHSASAPHLAAGSRESRKAQVEAELRD
AISALRKPNRDVVGKAMAEADQRRLLSAKKAKKQLSRAPVIVKATPAATRFTDVLAPDHHHHHRHHAPLLGIQES
PVPPSSDSNLIIPSTGQRSSHRDAFSAFAVAASSPPAADSNIVDDTPMKPPARPCFIRRAASEALALPAPPSSPL
AGAGGRKLLGLGASVGGGAGESIYRRLGWDDDDLDPLA*
Coding >Ophun1|6467
ATGTCCGGGACGCCGGCTGGCGGTACGGACGCGTCGCGCACGCGCGCCATCCTGACGCCCTCGTCTGATGGCAGC
GATGACGGCAAGAGGAGGGCTGATGCTGGGGCCATGGAGGAGCTGCTGCGGCCGTCGGTGGCAGTCAAGGTCGGC
GAATCGAATCCAACTTGCCCACGCCTTCTGCTGCCCTTGATGCTTCTACCGCGAGAGCATCTGTCGCTGGCGAGC
ATTGACTTTGGGGCTTCGGATCGGGATATGCCGTCCTCGCGATTGTTTGAGTCTCGTGTCAAGATGCTGGATCTT
GAGAGTCGGTTTGGTGCCCCGACCAGTGTTCTCGTTGCAAGGAACGAGGCTCGCGGCACTGTTCATGTTTTGGAG
CGGCAGGGGAGCAATGAAGGATTATACGTCATGTGTCAGCTGGGATCGTGGGTTGATCTCGCTGCGTTGGCGGGC
AAGGCGACGGCCGTTGCGTGGGAGCGGCTCCGGGCCCTGACGAGTCAACACCGGCCCGGGGGGAAGGGGAACGTC
CCATTGCCTGCGCCTCCGTTGTTCAAGGAGAGTGGGAGGAAGCGTGCTGCCATGGAGGCTGTTCAGTCTCTGGTC
AGGAAGCGGGTGAGGTCTCGGTCTATTTCGACGGCCAACGATGCGGGTCGCGACGTCCTGGCGCCGGTCAGCGGG
AATCAAGCTCGTCTTCAGACGCCGGGTTGTACGACGAAGCCGGAGGATGCGGAAAATGTGCTTGCGGATATTGCC
CCGGCTCTGGACCTCGATGGGATGGACTCTACGGCACAGCCCCCGGCTACGGCCGAGGCAATCTTTGACGGCATC
CGCTCGCAGTATTCCGAAGCTCTTTACAAATCTATGGGGTCTCTGGCGTACTTTGTAAAAGGACCTTTGTCGCGG
GCGCGGTCGGCGTTCCTTATTGATCTCGAATCGAGCCTGGACATGTCGGATCTGATCGACTTTCTGAAAAGTTTA
ATACTTACCACGGTGCAGATCGACACGAAATACCGCGACACGATCCCTGACCTCATAGCCAAGGTGGGCTTTGAC
GGCTCAGACGAGAACAGCAGCAAGCGGAAGCGGCGTCCTCGGAAGATGAAGATTGGCAAGTCGGGCCTCTTCCCT
CACGAAGATGAAAGCATCCGGAAATGGTGGGCGTCGAAGCAGCAACAGCAGCCGGGTGACAACCAGAGCAGCAGC
TCGACGGCAACGGCTCAGCTCAAGTCGCACGTATCGCTGCTACGCACCAGGGAGACGCAGCTGCAGATGATTATC
GCGCTCGAGATCTTGGCCCTCGAGCCGCTCAAGGCCGCCGAAGATGTCCTGCCGCGGCTGCCGGAGACCGAGCCG
AGCGGAGAGCCGACGACGCCGGTGCCGGCGCCTAGGAAGCGCAGCAGGTTGAACCTCCCGCTGCTGATTGATGTT
CATGCCGATCGCCTTACTATCTGGCAGTCGATTGCCTCGGATGAGCAGCTTGTGCTGGGGGAGTCGCAGGTTTCG
AGGCAGCCTGATGGGCAGCTTCAGCCGAGGACGTCGGCGGAGCCCCTGAAGGACTTTTGCGTCGACATCATTGTG
CCTTTCTTCTCTTCCCGTCTGCCGGAACTCTGCGACGGAATCAACCGCAAGCTCGGCGGCCCGCTACTGCTCTCA
CCCCCAAAGTCCAAGCCCTCGCGGACGGCGCCCAAGAAGCGAGAGCAGAAGCCCGGCACGGTAGCCAAGCGGCCG
ACGCCCGTCAGGTCGCAGAGGACGCTGCAGCGAGCGCTATCAGCCGAGCAGCAGCACCGCAGGAGCCTCTCCCGC
GGGCCAAGCAGCGCCATCGCCCAGCTGCGATCCACTACGACGGCGTCGCTCGTCAATGTCAAGAGGGAGGTCAGC
GACCCGGCGTCTGCGAGAGGCTTGAAGGAAGCGCCGAGGCTGGCGCCCGCGTGGAAGAGGCCGCCCCTGTCGCAT
AGCGCCAGCGCTCCTCACTTGGCCGCCGGCTCTAGGGAGAGTCGGAAGGCTCAGGTTGAGGCTGAGCTTAGGGAC
GCCATCTCGGCGTTGAGGAAGCCTAATCGCGATGTTGTTGGCAAGGCTATGGCTGAGGCTGACCAACGTCGTCTT
CTGTCGGCTAAGAAAGCCAAGAAACAGCTGTCTCGAGCCCCCGTCATCGTAAAGGCAACCCCAGCAGCAACCCGC
TTCACCGACGTCCTCGCCCCAGACCACCACCACCACCACCGCCATCACGCGCCTCTCCTCGGCATCCAAGAATCG
CCCGTCCCCCCCTCAAGCGACAGCAACCTCATCATCCCCTCAACGGGCCAGCGCTCCAGCCACAGAGACGCCTTC
TCCGCCTTCGCCGTCGCCGCCTCGTCGCCCCCCGCCGCGGACTCCAACATCGTCGACGACACGCCCATGAAGCCG
CCCGCCCGACCGTGTTTCATCCGGCGGGCTGCCAGCGAGGCTCTGGCCTTGCCGGCGCCGCCCTCTTCGCCTCTT
GCTGGGGCGGGGGGCAGGAAGTTGCTGGGATTGGGTGCGTCTGTTGGGGGTGGTGCTGGGGAGTCCATCTATCGT
CGGTTGGGGTGGGATGATGATGATTTGGATCCTTTGGCTTAG
Transcript >Ophun1|6467
ATGTCCGGGACGCCGGCTGGCGGTACGGACGCGTCGCGCACGCGCGCCATCCTGACGCCCTCGTCTGATGGCAGC
GATGACGGCAAGAGGAGGGCTGATGCTGGGGCCATGGAGGAGCTGCTGCGGCCGTCGGTGGCAGTCAAGGTCGGC
GAATCGAATCCAACTTGCCCACGCCTTCTGCTGCCCTTGATGCTTCTACCGCGAGAGCATCTGTCGCTGGCGAGC
ATTGACTTTGGGGCTTCGGATCGGGATATGCCGTCCTCGCGATTGTTTGAGTCTCGTGTCAAGATGCTGGATCTT
GAGAGTCGGTTTGGTGCCCCGACCAGTGTTCTCGTTGCAAGGAACGAGGCTCGCGGCACTGTTCATGTTTTGGAG
CGGCAGGGGAGCAATGAAGGATTATACGTCATGTGTCAGCTGGGATCGTGGGTTGATCTCGCTGCGTTGGCGGGC
AAGGCGACGGCCGTTGCGTGGGAGCGGCTCCGGGCCCTGACGAGTCAACACCGGCCCGGGGGGAAGGGGAACGTC
CCATTGCCTGCGCCTCCGTTGTTCAAGGAGAGTGGGAGGAAGCGTGCTGCCATGGAGGCTGTTCAGTCTCTGGTC
AGGAAGCGGGTGAGGTCTCGGTCTATTTCGACGGCCAACGATGCGGGTCGCGACGTCCTGGCGCCGGTCAGCGGG
AATCAAGCTCGTCTTCAGACGCCGGGTTGTACGACGAAGCCGGAGGATGCGGAAAATGTGCTTGCGGATATTGCC
CCGGCTCTGGACCTCGATGGGATGGACTCTACGGCACAGCCCCCGGCTACGGCCGAGGCAATCTTTGACGGCATC
CGCTCGCAGTATTCCGAAGCTCTTTACAAATCTATGGGGTCTCTGGCGTACTTTGTAAAAGGACCTTTGTCGCGG
GCGCGGTCGGCGTTCCTTATTGATCTCGAATCGAGCCTGGACATGTCGGATCTGATCGACTTTCTGAAAAGTTTA
ATACTTACCACGGTGCAGATCGACACGAAATACCGCGACACGATCCCTGACCTCATAGCCAAGGTGGGCTTTGAC
GGCTCAGACGAGAACAGCAGCAAGCGGAAGCGGCGTCCTCGGAAGATGAAGATTGGCAAGTCGGGCCTCTTCCCT
CACGAAGATGAAAGCATCCGGAAATGGTGGGCGTCGAAGCAGCAACAGCAGCCGGGTGACAACCAGAGCAGCAGC
TCGACGGCAACGGCTCAGCTCAAGTCGCACGTATCGCTGCTACGCACCAGGGAGACGCAGCTGCAGATGATTATC
GCGCTCGAGATCTTGGCCCTCGAGCCGCTCAAGGCCGCCGAAGATGTCCTGCCGCGGCTGCCGGAGACCGAGCCG
AGCGGAGAGCCGACGACGCCGGTGCCGGCGCCTAGGAAGCGCAGCAGGTTGAACCTCCCGCTGCTGATTGATGTT
CATGCCGATCGCCTTACTATCTGGCAGTCGATTGCCTCGGATGAGCAGCTTGTGCTGGGGGAGTCGCAGGTTTCG
AGGCAGCCTGATGGGCAGCTTCAGCCGAGGACGTCGGCGGAGCCCCTGAAGGACTTTTGCGTCGACATCATTGTG
CCTTTCTTCTCTTCCCGTCTGCCGGAACTCTGCGACGGAATCAACCGCAAGCTCGGCGGCCCGCTACTGCTCTCA
CCCCCAAAGTCCAAGCCCTCGCGGACGGCGCCCAAGAAGCGAGAGCAGAAGCCCGGCACGGTAGCCAAGCGGCCG
ACGCCCGTCAGGTCGCAGAGGACGCTGCAGCGAGCGCTATCAGCCGAGCAGCAGCACCGCAGGAGCCTCTCCCGC
GGGCCAAGCAGCGCCATCGCCCAGCTGCGATCCACTACGACGGCGTCGCTCGTCAATGTCAAGAGGGAGGTCAGC
GACCCGGCGTCTGCGAGAGGCTTGAAGGAAGCGCCGAGGCTGGCGCCCGCGTGGAAGAGGCCGCCCCTGTCGCAT
AGCGCCAGCGCTCCTCACTTGGCCGCCGGCTCTAGGGAGAGTCGGAAGGCTCAGGTTGAGGCTGAGCTTAGGGAC
GCCATCTCGGCGTTGAGGAAGCCTAATCGCGATGTTGTTGGCAAGGCTATGGCTGAGGCTGACCAACGTCGTCTT
CTGTCGGCTAAGAAAGCCAAGAAACAGCTGTCTCGAGCCCCCGTCATCGTAAAGGCAACCCCAGCAGCAACCCGC
TTCACCGACGTCCTCGCCCCAGACCACCACCACCACCACCGCCATCACGCGCCTCTCCTCGGCATCCAAGAATCG
CCCGTCCCCCCCTCAAGCGACAGCAACCTCATCATCCCCTCAACGGGCCAGCGCTCCAGCCACAGAGACGCCTTC
TCCGCCTTCGCCGTCGCCGCCTCGTCGCCCCCCGCCGCGGACTCCAACATCGTCGACGACACGCCCATGAAGCCG
CCCGCCCGACCGTGTTTCATCCGGCGGGCTGCCAGCGAGGCTCTGGCCTTGCCGGCGCCGCCCTCTTCGCCTCTT
GCTGGGGCGGGGGGCAGGAAGTTGCTGGGATTGGGTGCGTCTGTTGGGGGTGGTGCTGGGGAGTCCATCTATCGT
CGGTTGGGGTGGGATGATGATGATTTGGATCCTTTGGCTTAG
Gene >Ophun1|6467
ATGTCCGGGACGCCGGCTGGCGGTACGGACGCGTCGCGCACGCGCGCCATCCTGACGCCCTCGTCTGATGGCAGC
GATGACGGCAAGAGGAGGGCTGATGCTGGGGCCATGGAGGAGCTGCTGCGGCCGTCGGTGGCAGTCAAGGTCGGC
GAATCGAATCCAACTTGCGTGAGAGACTGGACTGACTTTGGCGATAGCCGCATCCTCCGCAGCTACACGTCCAGC
CACGCCTTCTGCTGCCCTTGATGCTTCTACCGCGAGAGCATCTGTCGCTGGCGAGCATTGACTTTGGGGCTTCGG
ATCGGGATATGCCGTCCTCGCGATTGTTTGAGTCTCGTGTCAAGATGCTGGATCTTGAGAGTCGGTTTGGTGCCC
CGACCAGTGTTCTCGTTGCAAGGAACGAGGCTCGCGGCACTGTTCATGTTTTGGAGCGGCAGGGGAGCAATGAAG
GATTATACGTCATGTGTCAGCTGGGATCGTGGGTTGATCTCGCTGCGTTGGCGGGCAAGGCGACGGCCGTTGCGT
GGGAGCGGCTCCGGGCCCTGACGAGTCAACACCGGCCCGGGGGGAAGGGGAACGTCCCATTGCCTGCGCCTCCGT
TGTTCAAGGAGAGTGGGAGGAAGCGTGCTGCCATGGAGGCTGTTCAGTCTCTGGTCAGGAAGCGGGTGAGGTCTC
GGTCTATTTCGACGGCCAACGATGCGGGTCGCGACGTCCTGGCGCCGGTCAGCGGGAATCAAGCTCGTCTTCAGA
CGCCGGGTTGTACGACGAAGCCGGAGGATGCGGAAAATGTGCTTGCGGATATTGCCCCGGCTCTGGACCTCGATG
GGATGGACTCTACGGCACAGCCCCCGGCTACGGCCGAGGCAATCTTTGACGGCATCCGCTCGCAGTATTCCGAAG
CTCTTTACAAATCTATGGTGGGTTCTCTCAGACTACGTCTCATAGTGGTTCTATCGCTGACAAGATTCAGGGGTC
TCTGGCGTACTTTGTAAAAGGACCTTTGTCGCGGGCGCGGTCGGCGTTCCTTATTGATCTCGAATCGAGCCTGGA
CATGTCGGATCTGATCGACTTTCTGAAAAGTTTAATACTTACCACGGTGCAGATCGACACGAAATACCGCGACAC
GATCCCTGACCTCATAGCCAAGGTGGGCTTTGACGGCTCAGACGAGAACAGCAGCAAGCGGAAGCGGCGTCCTCG
GAAGATGAAGATTGGCAAGTCGGGCCTCTTCCCTCACGAAGATGAAAGCATCCGGAAATGGTGGGCGTCGAAGCA
GCAACAGCAGCCGGGTGACAACCAGAGCAGCAGCTCGACGGCAACGGCTCAGCTCAAGTCGCACGTATCGCTGCT
ACGCACCAGGGAGACGCAGCTGCAGATGATTATCGCGCTCGAGATCTTGGCCCTCGAGCCGCTCAAGGCCGCCGA
AGATGTCCTGCCGCGGCTGCCGGAGACCGAGCCGAGCGGAGAGCCGACGACGCCGGTGCCGGCGCCTAGGAAGCG
CAGCAGGTTGAACCTCCCGCTGCTGATTGATGTTCATGCCGATCGCCTTACTATCTGGCAGTCGATTGCCTCGGA
TGAGCAGCTTGTGCTGGGGGAGTCGCAGGTTTCGAGGCAGCCTGATGGGCAGCTTCAGCCGAGGACGTCGGCGGA
GCCCCTGAAGGACTTTTGCGTCGACATCATTGTGCCTTTGTCAGTATACTTCTCTCTGTGTGGAACTGCTATCGA
TGAGGATCTGAAGCTAACATCTCACACAGCTTCTCTTCCCGTCTGCCGGAACTCTGCGACGGAATCAACCGCAAG
CTCGGCGGCCCGCTACTGCTCTCACCCCCAAAGTCCAAGCCCTCGCGGACGGCGCCCAAGAAGCGAGAGCAGAAG
CCCGGCACGGTAGCCAAGCGGCCGACGCCCGTCAGGTCGCAGAGGACGCTGCAGCGAGCGCTATCAGCCGAGCAG
CAGCACCGCAGGAGCCTCTCCCGCGGGCCAAGCAGCGCCATCGCCCAGCTGCGATCCACTACGACGGCGTCGCTC
GTCAATGTCAAGAGGGAGGTCAGCGACCCGGCGTCTGCGAGAGGCTTGAAGGAAGCGCCGAGGCTGGCGCCCGCG
TGGAAGAGGCCGCCCCTGTCGCATAGCGCCAGCGCTCCTCACTTGGCCGCCGGCTCTAGGGAGAGTCGGAAGGCT
CAGGTTGAGGCTGAGCTTAGGGACGCCATCTCGGCGTTGAGGAAGCCTAATCGCGATGTTGTTGGCAAGGCTATG
GCTGAGGCTGACCAACGTCGTCTTCTGTCGGCTAAGAGTGAGTTTCCTACTGGTTTACCCCTTCTCTTGAGCTGA
AGAGCCCGTCACTGACAACGAAGCAGAAGCCAAGAAACAGCTGTCTCGAGCCCCCGTCATCGTAAAGGCAACCCC
AGCAGCAACCCGCTTCACCGACGTCCTCGCCCCAGACCACCACCACCACCACCGCCATCACGCGCCTCTCCTCGG
CATCCAAGAATCGCCCGTCCCCCCCTCAAGCGACAGCAACCTCATCATCCCCTCAACGGGCCAGCGCTCCAGCCA
CAGAGACGCCTTCTCCGCCTTCGCCGTCGCCGCCTCGTCGCCCCCCGCCGCGGACTCCAACATCGTCGACGACAC
GCCCATGAAGCCGCCCGCCCGACCGTGTTTCATCCGGCGGGCTGCCAGCGAGGCTCTGGCCTTGCCGGCGCCGCC
CTCTTCGCCTCTTGCTGGGGCGGGGGGCAGGAAGTTGCTGGGATTGGGTGCGTCTGTTGGGGGTGGTGCTGGGGA
GTCCATCTATCGTCGGTTGGGGTGGGATGATGATGATTTGGATCCTTTGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail