Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6464
Gene name
LocationContig_705:6904..8581
Strand-
Gene length (bp)1677
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 1.4E-07 52 88
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 2.8E-06 105 172
PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain 5.5E-11 477 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4V2|AGM1_CANAX Phosphoacetylglucosamine mutase OS=Candida albicans GN=AGM1 PE=1 SV=1 12 554 5.0E-166
sp|Q09770|AGM2_SCHPO Phosphoacetylglucosamine mutase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1296.01c PE=1 SV=2 5 553 4.0E-161
sp|F1RQM2|AGM1_PIG Phosphoacetylglucosamine mutase OS=Sus scrofa GN=PGM3 PE=1 SV=2 5 555 7.0E-151
sp|O95394|AGM1_HUMAN Phosphoacetylglucosamine mutase OS=Homo sapiens GN=PGM3 PE=1 SV=1 5 556 8.0E-149
sp|Q9CYR6|AGM1_MOUSE Phosphoacetylglucosamine mutase OS=Mus musculus GN=Pgm3 PE=1 SV=1 1 556 1.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4V2|AGM1_CANAX Phosphoacetylglucosamine mutase OS=Candida albicans GN=AGM1 PE=1 SV=1 12 554 5.0E-166
sp|Q09770|AGM2_SCHPO Phosphoacetylglucosamine mutase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1296.01c PE=1 SV=2 5 553 4.0E-161
sp|F1RQM2|AGM1_PIG Phosphoacetylglucosamine mutase OS=Sus scrofa GN=PGM3 PE=1 SV=2 5 555 7.0E-151
sp|O95394|AGM1_HUMAN Phosphoacetylglucosamine mutase OS=Homo sapiens GN=PGM3 PE=1 SV=1 5 556 8.0E-149
sp|Q9CYR6|AGM1_MOUSE Phosphoacetylglucosamine mutase OS=Mus musculus GN=Pgm3 PE=1 SV=1 1 556 1.0E-146
sp|P38628|AGM1_YEAST Phosphoacetylglucosamine mutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCM1 PE=1 SV=2 20 554 4.0E-143
sp|Q09687|AGM1_SCHPO Phosphoacetylglucosamine mutase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.05c PE=1 SV=1 20 553 5.0E-139
sp|P57750|AGM1_ARATH Phosphoacetylglucosamine mutase OS=Arabidopsis thaliana GN=DRT101 PE=1 SV=1 1 556 1.0E-126
sp|Q6ZDQ1|AGM1_ORYSJ Phosphoacetylglucosamine mutase OS=Oryza sativa subsp. japonica GN=Os07g0195400 PE=2 SV=1 13 556 2.0E-122
sp|Q8SSL7|AGM1_ENCCU Probable phosphoacetylglucosamine mutase OS=Encephalitozoon cuniculi (strain GB-M1) GN=PCM1 PE=1 SV=1 1 553 4.0E-80
[Show less]

GO

GO Term Description Terminal node
GO:0016868 intramolecular transferase activity, phosphotransferases Yes
GO:0071704 organic substance metabolic process Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0016853 isomerase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6464
MDEKILAASAKYPTVAGHAYKYGTAGFRMKADLLSGVAFRVGLVAALRSRKLNGQAIGVMITASHNPAPDNGVKI
VDPMGEMLEQEWEAYATRLVNCPSDKALLDAYKALAAQLKIDLAAPGRVVYGRDTRPSGHSLATALAAALDATST
EFTDYKILTTPQLHYITRCVNSEGTPKSYGQPNERGYYSKFADAFVRALRGRKINGSLTIDCANGVGGPKIAELL
KVIPKDITGFDVKVVNDDVLRPEILNLEVSSPLKFLFMMLTLIAFYPQCGADHVKTKQRAPQTPKPVPGARCCSL
DGDADRLIYYWIDPEMGFVMLDGDRISSLTASFIGDLVRAADLEEDLRIGVVQTAYANGASTNYIEKHLRLPVVF
TPTGVKHLHHAACQFDIGVYFEANGHGTVVFSQEATRIFKAKEPQSPAQKDALETLSAVGDLINQTVGDAFTDML
LVETILAHKVWTLKDWAMTYTDLPNRLVRVEVGNKDLFQATDAERRLSHPPGAQDEIDQVVRKYTTARSFARASG
TENACRVYAEAATRSEADELANKIAQIVKQFGS*
Coding >Ophun1|6464
ATGGATGAAAAGATTCTCGCGGCCTCGGCCAAGTATCCGACAGTCGCCGGTCATGCCTACAAGTACGGCACCGCG
GGCTTCCGCATGAAGGCTGATCTGCTCTCCGGCGTCGCCTTTCGTGTCGGCCTCGTCGCCGCCCTTCGCAGCCGC
AAGCTCAACGGACAGGCCATCGGCGTCATGATAACTGCGAGCCACAACCCGGCTCCCGACAACGGCGTCAAAATC
GTTGACCCCATGGGCGAGATGCTCGAGCAGGAGTGGGAGGCCTATGCCACCCGCCTCGTCAACTGTCCTTCGGAC
AAGGCACTTCTCGATGCTTACAAGGCGCTGGCTGCCCAGCTCAAGATCGATCTCGCCGCTCCGGGCCGCGTCGTT
TACGGTCGCGACACTCGTCCTTCGGGCCACAGCCTCGCGACTGCCCTCGCGGCCGCTCTTGACGCCACCAGCACT
GAATTTACCGACTATAAGATACTGACTACACCTCAGTTACACTACATCACCCGCTGCGTCAACAGCGAGGGCACT
CCCAAGTCGTACGGCCAGCCCAACGAGCGCGGCTACTATTCCAAGTTCGCCGATGCCTTCGTCCGGGCTCTTCGC
GGTAGAAAAATTAATGGTTCGCTGACCATTGATTGCGCAAATGGTGTGGGCGGTCCCAAGATTGCGGAGCTGCTC
AAGGTTATCCCCAAGGATATCACGGGTTTCGACGTCAAGGTTGTCAATGACGACGTCCTCCGCCCGGAGATTCTC
AATCTCGAGGTAAGCAGTCCCCTCAAGTTCCTCTTCATGATGCTAACTCTTATTGCTTTCTACCCGCAGTGCGGT
GCCGATCACGTCAAGACGAAACAGCGTGCACCCCAGACACCCAAGCCCGTCCCTGGCGCTCGATGCTGCTCGTTG
GACGGCGACGCTGATCGGCTCATCTACTACTGGATCGACCCGGAGATGGGCTTCGTGATGCTCGACGGTGATCGT
ATCTCGTCCCTCACTGCCTCCTTCATTGGTGACCTCGTCCGCGCGGCCGATCTCGAGGAGGACCTCCGCATCGGT
GTCGTCCAGACAGCCTACGCCAACGGCGCGAGCACCAACTACATCGAGAAGCATCTGCGCCTCCCCGTCGTCTTT
ACGCCCACGGGGGTCAAGCATCTGCACCACGCGGCCTGTCAGTTCGACATTGGCGTCTACTTCGAGGCTAACGGC
CACGGGACTGTCGTCTTCTCGCAGGAGGCGACGCGCATCTTCAAGGCCAAGGAGCCGCAGTCGCCGGCGCAAAAG
GACGCGCTCGAGACGCTCAGCGCCGTGGGCGACCTCATCAACCAGACGGTGGGCGACGCCTTCACCGACATGCTC
CTGGTCGAGACGATCCTGGCACACAAGGTGTGGACGCTCAAGGACTGGGCCATGACGTACACGGACCTGCCCAAC
CGCCTGGTCCGCGTCGAGGTCGGCAACAAGGACCTCTTCCAGGCGACGGACGCCGAGCGCCGCCTCAGCCACCCG
CCCGGGGCCCAGGACGAGATCGACCAGGTGGTGCGCAAGTACACGACAGCCCGCTCCTTCGCCCGAGCCAGCGGC
ACGGAAAACGCATGCCGGGTCTACGCCGAGGCAGCGACGCGATCCGAAGCCGACGAGCTGGCCAACAAGATAGCC
CAGATTGTCAAGCAATTCGGATCGTAG
Transcript >Ophun1|6464
ATGGATGAAAAGATTCTCGCGGCCTCGGCCAAGTATCCGACAGTCGCCGGTCATGCCTACAAGTACGGCACCGCG
GGCTTCCGCATGAAGGCTGATCTGCTCTCCGGCGTCGCCTTTCGTGTCGGCCTCGTCGCCGCCCTTCGCAGCCGC
AAGCTCAACGGACAGGCCATCGGCGTCATGATAACTGCGAGCCACAACCCGGCTCCCGACAACGGCGTCAAAATC
GTTGACCCCATGGGCGAGATGCTCGAGCAGGAGTGGGAGGCCTATGCCACCCGCCTCGTCAACTGTCCTTCGGAC
AAGGCACTTCTCGATGCTTACAAGGCGCTGGCTGCCCAGCTCAAGATCGATCTCGCCGCTCCGGGCCGCGTCGTT
TACGGTCGCGACACTCGTCCTTCGGGCCACAGCCTCGCGACTGCCCTCGCGGCCGCTCTTGACGCCACCAGCACT
GAATTTACCGACTATAAGATACTGACTACACCTCAGTTACACTACATCACCCGCTGCGTCAACAGCGAGGGCACT
CCCAAGTCGTACGGCCAGCCCAACGAGCGCGGCTACTATTCCAAGTTCGCCGATGCCTTCGTCCGGGCTCTTCGC
GGTAGAAAAATTAATGGTTCGCTGACCATTGATTGCGCAAATGGTGTGGGCGGTCCCAAGATTGCGGAGCTGCTC
AAGGTTATCCCCAAGGATATCACGGGTTTCGACGTCAAGGTTGTCAATGACGACGTCCTCCGCCCGGAGATTCTC
AATCTCGAGGTAAGCAGTCCCCTCAAGTTCCTCTTCATGATGCTAACTCTTATTGCTTTCTACCCGCAGTGCGGT
GCCGATCACGTCAAGACGAAACAGCGTGCACCCCAGACACCCAAGCCCGTCCCTGGCGCTCGATGCTGCTCGTTG
GACGGCGACGCTGATCGGCTCATCTACTACTGGATCGACCCGGAGATGGGCTTCGTGATGCTCGACGGTGATCGT
ATCTCGTCCCTCACTGCCTCCTTCATTGGTGACCTCGTCCGCGCGGCCGATCTCGAGGAGGACCTCCGCATCGGT
GTCGTCCAGACAGCCTACGCCAACGGCGCGAGCACCAACTACATCGAGAAGCATCTGCGCCTCCCCGTCGTCTTT
ACGCCCACGGGGGTCAAGCATCTGCACCACGCGGCCTGTCAGTTCGACATTGGCGTCTACTTCGAGGCTAACGGC
CACGGGACTGTCGTCTTCTCGCAGGAGGCGACGCGCATCTTCAAGGCCAAGGAGCCGCAGTCGCCGGCGCAAAAG
GACGCGCTCGAGACGCTCAGCGCCGTGGGCGACCTCATCAACCAGACGGTGGGCGACGCCTTCACCGACATGCTC
CTGGTCGAGACGATCCTGGCACACAAGGTGTGGACGCTCAAGGACTGGGCCATGACGTACACGGACCTGCCCAAC
CGCCTGGTCCGCGTCGAGGTCGGCAACAAGGACCTCTTCCAGGCGACGGACGCCGAGCGCCGCCTCAGCCACCCG
CCCGGGGCCCAGGACGAGATCGACCAGGTGGTGCGCAAGTACACGACAGCCCGCTCCTTCGCCCGAGCCAGCGGC
ACGGAAAACGCATGCCGGGTCTACGCCGAGGCAGCGACGCGATCCGAAGCCGACGAGCTGGCCAACAAGATAGCC
CAGATTGTCAAGCAATTCGGATCGTAG
Gene >Ophun1|6464
ATGGATGAAAAGATTCTCGCGGCCTCGGCCAAGTATCCGACAGTCGCCGGTCATGCCTACAAGTACGGCACCGCG
GGCTTCCGCATGAAGGCTGATCTGCTCTCCGGCGTCGCCTTTCGTGTCGGCCTCGTCGCCGCCCTTCGCAGCCGC
AAGCTCAACGGACAGGCCATCGGCGTCATGATAACTGCGAGCCACAACCCGGCTCCCGACAACGGCGTCAAAATC
GTTGACCCCATGGGCGAGATGCTCGAGCAGGAGTGGGAGGCCTATGCCACCCGCCTCGTCAACTGTCCTTCGGAC
AAGGCACTTCTCGATGCTTACAAGGCGCTGGCTGCCCAGCTCAAGATCGATCTCGCCGCTCCGGGCCGCGTCGTT
TACGGTCGCGACACTCGTCCTTCGGGCCACAGCCTCGCGACTGCCCTCGCGGCCGCTCTTGACGCCACCAGCACT
GAATTTACCGACTATAAGATACTGACTACACCTCAGTTACACTACATCACCCGCTGCGTCAACAGCGAGGGCACT
CCCAAGTCGTACGGCCAGCCCAACGAGCGCGGCTACTATTCCAAGTTCGCCGATGCCTTCGTCCGGGCTCTTCGC
GGTAGAAAAATTAATGGTTCGCTGACCATTGATTGCGCAAATGGTGTGGGCGGTCCCAAGATTGCGGAGCTGCTC
AAGGTTATCCCCAAGGATATCACGGGTTTCGACGTCAAGGTTGTCAATGACGACGTCCTCCGCCCGGAGATTCTC
AATCTCGAGGTAAGCAGTCCCCTCAAGTTCCTCTTCATGATGCTAACTCTTATTGCTTTCTACCCGCAGTGCGGT
GCCGATCACGTCAAGACGAAACAGCGTGCACCCCAGACACCCAAGCCCGTCCCTGGCGCTCGATGCTGCTCGTTG
GACGGCGACGCTGATCGGCTCATCTACTACTGGATCGACCCGGAGATGGGCTTCGTGATGCTCGACGGTGATCGT
ATCTCGTCCCTCACTGCCTCCTTCATTGGTGACCTCGTCCGCGCGGCCGATCTCGAGGAGGACCTCCGCATCGGT
GTCGTCCAGACAGCCTACGCCAACGGCGCGAGCACCAACTACATCGAGAAGCATCTGCGCCTCCCCGTCGTCTTT
ACGCCCACGGGGGTCAAGCATCTGCACCACGCGGCCTGTCAGTTCGACATTGGCGTCTACTTCGAGGCTAACGGC
CACGGGACTGTCGTCTTCTCGCAGGAGGCGACGCGCATCTTCAAGGCCAAGGAGCCGCAGTCGCCGGCGCAAAAG
GACGCGCTCGAGACGCTCAGCGCCGTGGGCGACCTCATCAACCAGACGGTGGGCGACGCCTTCACCGACATGCTC
CTGGTCGAGACGATCCTGGCACACAAGGTGTGGACGCTCAAGGACTGGGCCATGACGTACACGGACCTGCCCAAC
CGCCTGGTCCGCGTCGAGGTCGGCAACAAGGACCTCTTCCAGGCGACGGACGCCGAGCGCCGCCTCAGCCACCCG
CCCGGGGCCCAGGACGAGATCGACCAGGTGGTGCGCAAGTACACGACAGCCCGCTCCTTCGCCCGAGCCAGCGGC
ACGGAAAACGCATGCCGGGTCTACGCCGAGGCAGCGACGCGATCCGAAGCCGACGAGCTGGCCAACAAGATAGCC
CAGATTGTCAAGCAATTCGGATCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail