Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6461
Gene name
LocationContig_705:476..2144
Strand+
Gene length (bp)1668
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.6E-44 192 471
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.3E-18 197 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 157 491 6.0E-83
sp|O94235|MPH1L_SCHPO Serine/threonine-protein kinase mph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mph1 PE=2 SV=1 96 472 9.0E-82
sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mps1 OS=Dictyostelium discoideum GN=mps1 PE=3 SV=1 178 471 7.0E-78
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 185 471 3.0E-65
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 185 499 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 157 491 6.0E-83
sp|O94235|MPH1L_SCHPO Serine/threonine-protein kinase mph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mph1 PE=2 SV=1 96 472 9.0E-82
sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mps1 OS=Dictyostelium discoideum GN=mps1 PE=3 SV=1 178 471 7.0E-78
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 185 471 3.0E-65
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 185 499 1.0E-63
sp|Q4R945|TTK_MACFA Dual specificity protein kinase TTK OS=Macaca fascicularis GN=TTK PE=2 SV=1 160 471 4.0E-62
sp|P33981|TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens GN=TTK PE=1 SV=2 157 471 2.0E-61
sp|Q8SSH4|MPS1_ENCCU Probable serine/threonine-protein kinase MPS1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MPS1 PE=3 SV=1 178 471 1.0E-47
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 198 442 3.0E-21
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 187 413 5.0E-21
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 187 413 1.0E-20
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 187 440 1.0E-20
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 187 413 2.0E-20
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 187 413 2.0E-20
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 188 440 2.0E-20
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 192 471 3.0E-20
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 192 471 2.0E-19
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 180 471 2.0E-19
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 188 440 3.0E-19
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 192 413 3.0E-19
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 192 471 4.0E-19
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 192 471 7.0E-19
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 192 471 7.0E-19
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 192 413 9.0E-19
sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 191 471 1.0E-18
sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 191 471 1.0E-18
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 150 471 1.0E-18
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 192 437 2.0E-18
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 192 436 2.0E-18
sp|Q2UGZ7|ATG1_ASPOR Serine/threonine-protein kinase atg1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg1 PE=3 SV=1 192 436 3.0E-18
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 190 471 3.0E-18
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 192 413 3.0E-18
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 192 471 3.0E-18
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 198 470 4.0E-18
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 190 413 4.0E-18
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 276 439 4.0E-18
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 192 436 5.0E-18
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 192 436 5.0E-18
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 192 413 5.0E-18
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 192 436 6.0E-18
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 192 436 6.0E-18
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 192 436 7.0E-18
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 198 436 8.0E-18
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 192 413 8.0E-18
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 192 471 8.0E-18
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 292 438 8.0E-18
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 192 436 9.0E-18
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 198 436 1.0E-17
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 276 439 1.0E-17
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 276 439 1.0E-17
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 192 436 1.0E-17
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 192 436 1.0E-17
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 292 438 1.0E-17
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 192 413 1.0E-17
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 276 413 2.0E-17
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 276 413 2.0E-17
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 175 462 2.0E-17
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 292 438 2.0E-17
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 192 471 2.0E-17
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 175 462 2.0E-17
sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg1 PE=3 SV=1 192 436 2.0E-17
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 181 455 2.0E-17
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 175 462 2.0E-17
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 197 471 3.0E-17
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 189 422 3.0E-17
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 134 413 3.0E-17
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 192 471 4.0E-17
sp|Q3V3A1|CDK15_MOUSE Cyclin-dependent kinase 15 OS=Mus musculus GN=Cdk15 PE=2 SV=2 192 430 4.0E-17
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 286 436 4.0E-17
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 192 471 4.0E-17
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 198 460 6.0E-17
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 185 461 6.0E-17
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 192 413 7.0E-17
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 167 413 7.0E-17
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 192 413 7.0E-17
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 192 437 7.0E-17
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 192 437 7.0E-17
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 192 413 7.0E-17
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 151 413 7.0E-17
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 151 413 7.0E-17
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 151 413 8.0E-17
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 192 413 8.0E-17
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 151 413 8.0E-17
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 151 413 8.0E-17
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 165 415 8.0E-17
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 292 438 8.0E-17
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 190 471 9.0E-17
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 183 413 1.0E-16
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 192 437 1.0E-16
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 138 471 1.0E-16
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 176 433 1.0E-16
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 192 415 1.0E-16
sp|A2QIL5|ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg1 PE=3 SV=1 192 438 1.0E-16
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 192 415 1.0E-16
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 192 413 1.0E-16
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 181 455 1.0E-16
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 177 443 1.0E-16
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 185 436 1.0E-16
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 196 434 1.0E-16
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 196 434 1.0E-16
sp|A7F0W2|ATG1_SCLS1 Serine/threonine-protein kinase ATG1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ATG1 PE=3 SV=1 191 440 2.0E-16
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 192 413 2.0E-16
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 192 436 2.0E-16
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 185 436 2.0E-16
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 185 462 2.0E-16
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 198 471 2.0E-16
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 192 414 2.0E-16
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 177 434 2.0E-16
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 185 436 2.0E-16
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 192 413 2.0E-16
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 192 413 2.0E-16
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 192 463 2.0E-16
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 188 413 3.0E-16
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 192 460 3.0E-16
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 185 436 3.0E-16
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 185 436 3.0E-16
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 296 463 3.0E-16
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 296 463 3.0E-16
sp|Q5BCU8|ATG1_EMENI Serine/threonine-protein kinase atg1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg1 PE=3 SV=1 192 436 3.0E-16
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 189 422 4.0E-16
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 185 436 4.0E-16
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 196 415 4.0E-16
sp|Q96Q40|CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens GN=CDK15 PE=1 SV=2 192 430 4.0E-16
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 198 431 4.0E-16
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 192 427 4.0E-16
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 192 422 5.0E-16
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 198 431 5.0E-16
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 192 413 5.0E-16
sp|Q0KHT7|DAPKR_DROME Death-associated protein kinase related OS=Drosophila melanogaster GN=Drak PE=1 SV=2 198 457 5.0E-16
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 189 413 5.0E-16
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 196 429 6.0E-16
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 198 471 6.0E-16
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 198 431 6.0E-16
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 198 465 7.0E-16
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 198 431 8.0E-16
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 196 415 8.0E-16
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 198 437 8.0E-16
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 192 413 8.0E-16
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 185 413 8.0E-16
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 196 434 9.0E-16
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 198 431 9.0E-16
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 192 471 1.0E-15
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 181 436 1.0E-15
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 192 413 1.0E-15
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 181 436 1.0E-15
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 286 436 1.0E-15
sp|Q9WTK7|STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus GN=Stk11 PE=1 SV=1 236 413 1.0E-15
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 192 452 1.0E-15
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 198 431 1.0E-15
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 192 413 2.0E-15
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 185 411 2.0E-15
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 192 413 2.0E-15
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 170 413 2.0E-15
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 190 413 2.0E-15
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 236 413 2.0E-15
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 190 413 2.0E-15
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 198 413 2.0E-15
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 190 413 2.0E-15
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 198 438 3.0E-15
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 186 443 3.0E-15
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 192 413 3.0E-15
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 192 413 3.0E-15
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 178 433 3.0E-15
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 192 413 3.0E-15
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 198 413 3.0E-15
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 185 411 3.0E-15
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 192 413 3.0E-15
sp|Q1DN93|ATG1_COCIM Serine/threonine-protein kinase ATG1 OS=Coccidioides immitis (strain RS) GN=ATG1 PE=3 SV=1 192 497 3.0E-15
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 192 413 3.0E-15
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 192 471 3.0E-15
sp|Q0GGW5|STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus GN=STK11 PE=2 SV=1 236 413 4.0E-15
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 116 433 4.0E-15
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 186 413 4.0E-15
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 198 438 4.0E-15
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 199 471 4.0E-15
sp|Q556J6|Y4007_DICDI Putative cyclin-dependent serine/threonine-protein kinase DDB_G0272797/DDB_G0274007 OS=Dictyostelium discoideum GN=DDB_G0272797 PE=3 SV=1 192 407 4.0E-15
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 148 437 4.0E-15
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 192 522 5.0E-15
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 192 471 5.0E-15
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 192 413 6.0E-15
sp|Q63686|CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus GN=Cdk16 PE=1 SV=1 190 413 6.0E-15
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 198 472 6.0E-15
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 192 413 6.0E-15
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 192 452 6.0E-15
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 190 413 7.0E-15
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 197 413 7.0E-15
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 192 412 7.0E-15
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 192 471 8.0E-15
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 192 436 8.0E-15
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 298 438 8.0E-15
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 192 413 9.0E-15
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 192 413 9.0E-15
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 185 411 9.0E-15
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 289 433 9.0E-15
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 251 436 9.0E-15
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 198 471 1.0E-14
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 188 464 1.0E-14
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 192 413 1.0E-14
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 192 413 1.0E-14
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 166 413 1.0E-14
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 298 438 1.0E-14
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 186 438 1.0E-14
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 192 413 1.0E-14
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 185 414 1.0E-14
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 192 440 1.0E-14
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 298 438 1.0E-14
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 187 413 2.0E-14
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 196 413 2.0E-14
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 192 436 2.0E-14
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 198 471 2.0E-14
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 192 471 2.0E-14
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 189 413 2.0E-14
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 192 413 2.0E-14
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 198 413 2.0E-14
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 298 448 2.0E-14
sp|A4IIW7|CDK14_XENTR Cyclin-dependent kinase 14 OS=Xenopus tropicalis GN=cdk14 PE=2 SV=1 192 427 2.0E-14
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 198 413 2.0E-14
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 308 530 2.0E-14
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 170 436 2.0E-14
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 196 413 2.0E-14
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 192 413 2.0E-14
sp|Q91604|STK11_XENLA Serine/threonine-protein kinase stk11 OS=Xenopus laevis GN=stk11 PE=1 SV=1 236 413 2.0E-14
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 198 413 2.0E-14
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 192 471 2.0E-14
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 196 413 2.0E-14
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 194 411 2.0E-14
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 198 438 2.0E-14
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 192 413 3.0E-14
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 201 471 3.0E-14
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 198 413 3.0E-14
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 196 413 3.0E-14
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 192 438 3.0E-14
sp|Q5RD01|CDK18_PONAB Cyclin-dependent kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2 190 413 3.0E-14
sp|Q6DJM7|CDK14_XENLA Cyclin-dependent kinase 14 OS=Xenopus laevis GN=cdk14 PE=2 SV=1 192 427 3.0E-14
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 196 415 3.0E-14
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 192 413 3.0E-14
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 251 413 4.0E-14
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 192 470 4.0E-14
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 192 438 4.0E-14
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 192 438 4.0E-14
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 192 438 4.0E-14
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 170 458 4.0E-14
sp|Q07002|CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3 190 413 4.0E-14
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 192 436 4.0E-14
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 196 413 5.0E-14
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 192 421 5.0E-14
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 192 433 5.0E-14
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 186 413 5.0E-14
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 186 438 5.0E-14
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 192 437 5.0E-14
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 192 472 5.0E-14
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 288 413 6.0E-14
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 192 428 6.0E-14
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 192 471 6.0E-14
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 192 413 6.0E-14
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 198 415 6.0E-14
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 192 471 6.0E-14
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 236 413 6.0E-14
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 186 439 7.0E-14
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 196 415 7.0E-14
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 186 438 7.0E-14
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 192 413 7.0E-14
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 189 438 7.0E-14
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 192 419 7.0E-14
sp|Q7RX99|ATG1_NEUCR Serine/threonine-protein kinase apg-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-1 PE=3 SV=2 198 435 7.0E-14
sp|Q8NU98|PKN1_CORGL Probable serine/threonine-protein kinase PknB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknB PE=3 SV=1 197 413 7.0E-14
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 187 471 7.0E-14
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 192 413 8.0E-14
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 178 413 8.0E-14
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 192 471 8.0E-14
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 197 430 8.0E-14
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 198 430 8.0E-14
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 192 413 8.0E-14
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 292 422 8.0E-14
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 192 407 8.0E-14
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 163 413 9.0E-14
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 198 413 9.0E-14
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 198 413 9.0E-14
sp|B6A7Q3|CDK14_RABIT Cyclin-dependent kinase 14 OS=Oryctolagus cuniculus GN=CDK14 PE=3 SV=1 192 422 9.0E-14
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 192 471 9.0E-14
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 189 413 9.0E-14
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 190 413 9.0E-14
sp|O42781|MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii GN=MKP2 PE=1 SV=1 192 413 9.0E-14
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 198 471 1.0E-13
sp|C0RW22|CDK14_DASNO Cyclin-dependent kinase 14 OS=Dasypus novemcinctus GN=CDK14 PE=3 SV=1 192 427 1.0E-13
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 162 472 1.0E-13
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 190 413 1.0E-13
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 168 413 1.0E-13
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 192 413 1.0E-13
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 166 463 1.0E-13
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 192 413 1.0E-13
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 192 413 1.0E-13
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 192 471 1.0E-13
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 302 530 1.0E-13
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 191 411 1.0E-13
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 192 436 1.0E-13
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 192 436 1.0E-13
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 198 413 1.0E-13
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 192 436 1.0E-13
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 192 413 1.0E-13
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 192 436 1.0E-13
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 183 433 1.0E-13
sp|B0VXL7|CDK14_CALMO Cyclin-dependent kinase 14 OS=Callicebus moloch GN=CDK14 PE=3 SV=1 192 413 1.0E-13
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 192 413 1.0E-13
sp|O35495|CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus GN=Cdk14 PE=1 SV=2 192 422 1.0E-13
sp|B0VXE8|CDK14_CALJA Cyclin-dependent kinase 14 OS=Callithrix jacchus GN=CDK14 PE=3 SV=1 192 427 1.0E-13
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 192 470 1.0E-13
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 192 413 1.0E-13
sp|O94921|CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens GN=CDK14 PE=1 SV=3 192 427 2.0E-13
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 192 413 2.0E-13
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 192 413 2.0E-13
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 192 413 2.0E-13
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 189 438 2.0E-13
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 198 433 2.0E-13
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 195 413 2.0E-13
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 192 407 2.0E-13
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 192 407 2.0E-13
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 192 471 2.0E-13
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 192 407 2.0E-13
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 192 413 2.0E-13
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 186 413 2.0E-13
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 166 463 2.0E-13
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 198 478 2.0E-13
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 101 413 2.0E-13
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 192 413 2.0E-13
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 171 413 2.0E-13
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 297 478 2.0E-13
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 196 428 2.0E-13
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 198 413 2.0E-13
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 288 413 2.0E-13
sp|Q54LH8|Y6627_DICDI Probable serine/threonine-protein kinase DDB_G0286627 OS=Dictyostelium discoideum GN=DDB_G0286627 PE=3 SV=1 198 410 2.0E-13
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 196 471 2.0E-13
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 192 438 2.0E-13
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 159 419 2.0E-13
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 190 407 3.0E-13
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 292 437 3.0E-13
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 192 413 3.0E-13
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 192 414 3.0E-13
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 197 471 3.0E-13
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 177 413 3.0E-13
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 185 470 3.0E-13
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 198 430 3.0E-13
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 190 413 3.0E-13
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 192 413 3.0E-13
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 192 471 3.0E-13
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 196 436 3.0E-13
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 198 426 3.0E-13
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 198 413 3.0E-13
sp|Q5JK68|CDKC2_ORYSJ Cyclin-dependent kinase C-2 OS=Oryza sativa subsp. japonica GN=CDKC-2 PE=2 SV=1 191 411 3.0E-13
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 192 413 3.0E-13
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 195 419 4.0E-13
sp|Q3ZDQ4|ATG1_PODAS Serine/threonine-protein kinase ATG1 OS=Podospora anserina GN=ATG1 PE=2 SV=1 198 471 4.0E-13
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 179 438 4.0E-13
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 292 437 4.0E-13
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 175 413 4.0E-13
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 190 471 4.0E-13
sp|P49071|MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster GN=MAPk-Ak2 PE=2 SV=1 198 413 5.0E-13
sp|O43066|PPK30_SCHPO Serine/threonine-protein kinase ppk30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk30 PE=1 SV=1 148 418 5.0E-13
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 192 413 5.0E-13
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 198 440 5.0E-13
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 182 436 5.0E-13
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 198 413 5.0E-13
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 297 413 5.0E-13
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 197 413 5.0E-13
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 238 413 5.0E-13
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 198 471 5.0E-13
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 296 413 6.0E-13
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 196 423 6.0E-13
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 192 413 6.0E-13
sp|P25859|CKB11_ARATH Cyclin-dependent kinase B1-1 OS=Arabidopsis thaliana GN=CDKB1-1 PE=1 SV=2 192 407 6.0E-13
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 195 428 6.0E-13
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 192 413 6.0E-13
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 198 471 7.0E-13
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 198 413 7.0E-13
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 292 437 7.0E-13
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 238 413 7.0E-13
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 181 424 7.0E-13
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 186 413 8.0E-13
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 191 471 8.0E-13
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 296 413 8.0E-13
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 177 413 8.0E-13
sp|P34314|TLK1_CAEEL Serine/threonine-protein kinase tousled-like 1 OS=Caenorhabditis elegans GN=tlk-1 PE=1 SV=3 170 470 8.0E-13
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 303 530 8.0E-13
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 192 471 8.0E-13
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 190 426 9.0E-13
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 296 436 9.0E-13
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 177 413 9.0E-13
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 190 426 9.0E-13
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 196 423 9.0E-13
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 195 438 1.0E-12
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 190 426 1.0E-12
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 296 436 1.0E-12
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 192 471 1.0E-12
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 192 471 1.0E-12
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 264 413 1.0E-12
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 196 436 1.0E-12
sp|Q52EB3|ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG1 PE=1 SV=1 198 436 1.0E-12
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 185 470 1.0E-12
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 165 413 1.0E-12
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 198 413 1.0E-12
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 192 413 1.0E-12
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 238 470 1.0E-12
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 198 413 1.0E-12
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 192 472 1.0E-12
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 198 480 1.0E-12
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 198 413 1.0E-12
sp|Q62070|PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus GN=Pim2 PE=1 SV=1 198 472 1.0E-12
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 198 426 2.0E-12
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 177 414 2.0E-12
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 238 421 2.0E-12
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 192 422 2.0E-12
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 198 435 2.0E-12
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 192 427 2.0E-12
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 198 413 2.0E-12
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 198 430 2.0E-12
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 192 422 2.0E-12
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 192 422 2.0E-12
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 198 471 2.0E-12
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 298 413 2.0E-12
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 192 413 2.0E-12
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 196 423 2.0E-12
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 296 413 2.0E-12
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 192 471 2.0E-12
sp|Q9LSF1|OXI1_ARATH Serine/threonine-protein kinase OXI1 OS=Arabidopsis thaliana GN=OXI1 PE=1 SV=1 195 413 2.0E-12
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 192 414 2.0E-12
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 296 413 2.0E-12
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 251 413 2.0E-12
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 198 413 2.0E-12
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 296 413 2.0E-12
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 192 413 2.0E-12
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 277 413 2.0E-12
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 277 413 2.0E-12
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 192 413 2.0E-12
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 192 413 2.0E-12
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 195 428 2.0E-12
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 229 413 2.0E-12
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 198 437 2.0E-12
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 192 422 2.0E-12
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 192 413 2.0E-12
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 292 414 3.0E-12
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 197 471 3.0E-12
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 190 471 3.0E-12
sp|Q9V3D5|DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster GN=Dyrk2 PE=1 SV=1 192 413 3.0E-12
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 197 413 3.0E-12
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 187 413 3.0E-12
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 196 519 3.0E-12
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 187 413 3.0E-12
sp|O14976|GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens GN=GAK PE=1 SV=2 198 413 3.0E-12
sp|A8C984|MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio GN=mylk3 PE=2 SV=1 195 413 3.0E-12
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 185 411 3.0E-12
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 198 471 3.0E-12
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 177 413 4.0E-12
sp|Q0TWJ7|SSN3_PHANO Serine/threonine-protein kinase SSN3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SSN3 PE=3 SV=1 186 413 4.0E-12
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 303 413 4.0E-12
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 198 435 4.0E-12
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 187 413 4.0E-12
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 198 443 4.0E-12
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 198 443 4.0E-12
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 286 442 4.0E-12
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 192 437 4.0E-12
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 192 414 4.0E-12
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 187 413 4.0E-12
sp|Q8FUI5|PKN1_COREF Probable serine/threonine-protein kinase CE0033 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0033 PE=3 SV=1 307 413 4.0E-12
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 177 413 4.0E-12
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 198 471 4.0E-12
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 192 413 4.0E-12
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 198 416 4.0E-12
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 192 413 5.0E-12
sp|Q09690|POM1_SCHPO Dual specificity protein kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pom1 PE=1 SV=1 192 413 5.0E-12
sp|Q9UQ07|MOK_HUMAN MAPK/MAK/MRK overlapping kinase OS=Homo sapiens GN=MOK PE=2 SV=1 190 471 5.0E-12
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 186 413 5.0E-12
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 189 414 5.0E-12
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 190 413 5.0E-12
sp|P33973|PKN1_MYXXA Serine/threonine-protein kinase Pkn1 OS=Myxococcus xanthus GN=pkn1 PE=1 SV=1 198 413 5.0E-12
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 190 413 5.0E-12
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 238 421 5.0E-12
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 186 413 6.0E-12
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 179 413 6.0E-12
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 198 414 6.0E-12
sp|Q9XBQ0|PKN3_MYXXA Serine/threonine-protein kinase pkn3 OS=Myxococcus xanthus GN=pkn3 PE=3 SV=1 197 469 6.0E-12
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 300 430 6.0E-12
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 189 413 7.0E-12
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 198 413 7.0E-12
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 192 475 7.0E-12
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 192 422 7.0E-12
sp|Q552C6|ZAK2_DICDI Dual specificity protein kinase zak2 OS=Dictyostelium discoideum GN=zak2 PE=1 SV=1 281 471 7.0E-12
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 197 428 7.0E-12
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 192 411 7.0E-12
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 186 413 7.0E-12
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 304 448 7.0E-12
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 192 413 8.0E-12
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 291 430 8.0E-12
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 277 417 8.0E-12
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 198 430 8.0E-12
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 192 406 9.0E-12
sp|Q9WVS4|MOK_MOUSE MAPK/MAK/MRK overlapping kinase OS=Mus musculus GN=Mok PE=1 SV=1 190 445 9.0E-12
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 198 413 1.0E-11
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 213 413 1.0E-11
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 198 471 1.0E-11
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 290 413 1.0E-11
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 198 413 1.0E-06
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 198 413 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6461
MRFKRVGKIPGSFLSGPARRGRRRQSEEDADGDDDNVGQDEPRPVDDFDAPPPSPPARFVDGIGSFNSGSPVVGN
ARALLQRRQIPTPPDEEPVLFAPEPAPEHDQENLVPGRSKRPSAISTDQPPLSQPAALKALPQRSSTDRRPLAEL
LNNSTPHRAPPPPPPKMSVLEAATTARAKQRRNVIRVNGKCYTRLDCLGRGGSAKVYRVTAENGNMFALKRVSLD
HADETTVRGYKGEMELLNRLGGVDRVIKLFDHELNSEKQVLTLLMELGELDLNKLMSSRQNPEKARFDAVFVRFY
WKEMVECLEAVHRHDIVHSDLKPANFVLVRGRLKLIDFGIANAIQTDETVNVHRETQIGTPNYMSPESLMDANSG
GPRAARPARPRLMKLGKPSDVWSLGCILYQMVYGLPPFGHIANQMARCQAIVNWDHAIDFPSRAMGGVPVPPSLM
KTMRRCLSREQHLRPTCAELLLPTDGFLYPSEVADGALAVDEELLARLVQSVVSRCRERMPSEAEVLGAWPQAYW
ASIRKAAASKT*
Coding >Ophun1|6461
ATGCGATTCAAGCGCGTCGGCAAGATCCCCGGTAGCTTTCTCAGCGGTCCTGCCCGCCGCGGACGGAGACGACAG
AGTGAGGAGGACGCCGATGGCGATGACGATAACGTCGGGCAGGATGAGCCGCGGCCGGTCGATGACTTTGACGCG
CCGCCACCGTCTCCGCCGGCTCGGTTCGTCGACGGCATCGGGAGCTTCAACTCCGGTAGCCCCGTCGTCGGTAAC
GCCCGGGCCTTGCTGCAGCGGAGGCAGATACCCACGCCGCCGGACGAGGAACCGGTCCTTTTCGCACCGGAGCCG
GCGCCGGAGCACGATCAGGAGAATCTGGTCCCGGGCCGGAGCAAGAGACCGTCGGCTATATCAACCGACCAGCCT
CCTCTCTCACAACCTGCCGCCCTTAAAGCTCTCCCCCAACGATCTTCCACCGACCGCCGACCGCTGGCAGAGCTC
CTCAACAACAGCACGCCTCACCGGGCGCCTCCCCCGCCGCCGCCCAAGATGTCAGTCCTGGAGGCGGCAACAACA
GCGCGAGCCAAGCAGCGACGCAACGTCATCCGCGTCAACGGCAAATGCTACACGCGTCTCGACTGCCTCGGCCGC
GGCGGCAGCGCAAAAGTGTATCGCGTGACGGCTGAGAATGGAAACATGTTTGCGCTGAAGCGTGTTTCGCTCGAT
CACGCTGATGAGACGACGGTCCGGGGCTACAAGGGCGAGATGGAGCTGCTGAATCGACTGGGGGGTGTCGATCGT
GTCATCAAGCTCTTTGACCATGAGCTGAATTCTGAGAAGCAGGTTCTGACCTTGCTCATGGAACTTGGCGAGCTC
GACCTCAACAAGCTCATGTCTTCCCGCCAGAACCCGGAAAAGGCCCGGTTCGACGCCGTCTTCGTCCGCTTCTAC
TGGAAAGAGATGGTGGAGTGTCTGGAAGCCGTCCACCGACACGACATCGTCCACTCCGATCTCAAGCCCGCAAAC
TTCGTCCTCGTCCGCGGCCGGCTGAAGCTCATCGACTTTGGCATCGCAAACGCCATCCAGACGGACGAGACTGTC
AATGTTCACCGCGAGACGCAGATTGGCACGCCCAATTACATGTCTCCCGAGTCGCTCATGGACGCCAATAGCGGC
GGCCCGCGAGCTGCCAGACCGGCTCGGCCGCGGCTCATGAAGCTCGGGAAGCCGAGTGACGTCTGGTCTCTCGGC
TGTATTCTGTACCAGATGGTCTACGGCCTACCGCCCTTTGGCCACATCGCCAACCAGATGGCTCGCTGCCAGGCC
ATCGTCAACTGGGATCATGCCATCGACTTCCCCTCGCGTGCCATGGGTGGCGTCCCTGTTCCACCCTCGCTGATG
AAGACGATGCGTCGCTGTCTGAGTCGCGAGCAGCATCTTCGTCCCACCTGCGCAGAGCTGCTTCTCCCTACCGAC
GGCTTCCTCTATCCTTCCGAGGTGGCCGACGGCGCCCTGGCCGTTGACGAGGAATTACTCGCTCGCCTCGTCCAG
AGCGTCGTCTCTCGGTGTCGCGAGCGTATGCCCTCCGAGGCAGAAGTTCTCGGCGCGTGGCCTCAGGCTTACTGG
GCTAGCATACGCAAAGCTGCTGCGAGCAAGACCTGA
Transcript >Ophun1|6461
ATGCGATTCAAGCGCGTCGGCAAGATCCCCGGTAGCTTTCTCAGCGGTCCTGCCCGCCGCGGACGGAGACGACAG
AGTGAGGAGGACGCCGATGGCGATGACGATAACGTCGGGCAGGATGAGCCGCGGCCGGTCGATGACTTTGACGCG
CCGCCACCGTCTCCGCCGGCTCGGTTCGTCGACGGCATCGGGAGCTTCAACTCCGGTAGCCCCGTCGTCGGTAAC
GCCCGGGCCTTGCTGCAGCGGAGGCAGATACCCACGCCGCCGGACGAGGAACCGGTCCTTTTCGCACCGGAGCCG
GCGCCGGAGCACGATCAGGAGAATCTGGTCCCGGGCCGGAGCAAGAGACCGTCGGCTATATCAACCGACCAGCCT
CCTCTCTCACAACCTGCCGCCCTTAAAGCTCTCCCCCAACGATCTTCCACCGACCGCCGACCGCTGGCAGAGCTC
CTCAACAACAGCACGCCTCACCGGGCGCCTCCCCCGCCGCCGCCCAAGATGTCAGTCCTGGAGGCGGCAACAACA
GCGCGAGCCAAGCAGCGACGCAACGTCATCCGCGTCAACGGCAAATGCTACACGCGTCTCGACTGCCTCGGCCGC
GGCGGCAGCGCAAAAGTGTATCGCGTGACGGCTGAGAATGGAAACATGTTTGCGCTGAAGCGTGTTTCGCTCGAT
CACGCTGATGAGACGACGGTCCGGGGCTACAAGGGCGAGATGGAGCTGCTGAATCGACTGGGGGGTGTCGATCGT
GTCATCAAGCTCTTTGACCATGAGCTGAATTCTGAGAAGCAGGTTCTGACCTTGCTCATGGAACTTGGCGAGCTC
GACCTCAACAAGCTCATGTCTTCCCGCCAGAACCCGGAAAAGGCCCGGTTCGACGCCGTCTTCGTCCGCTTCTAC
TGGAAAGAGATGGTGGAGTGTCTGGAAGCCGTCCACCGACACGACATCGTCCACTCCGATCTCAAGCCCGCAAAC
TTCGTCCTCGTCCGCGGCCGGCTGAAGCTCATCGACTTTGGCATCGCAAACGCCATCCAGACGGACGAGACTGTC
AATGTTCACCGCGAGACGCAGATTGGCACGCCCAATTACATGTCTCCCGAGTCGCTCATGGACGCCAATAGCGGC
GGCCCGCGAGCTGCCAGACCGGCTCGGCCGCGGCTCATGAAGCTCGGGAAGCCGAGTGACGTCTGGTCTCTCGGC
TGTATTCTGTACCAGATGGTCTACGGCCTACCGCCCTTTGGCCACATCGCCAACCAGATGGCTCGCTGCCAGGCC
ATCGTCAACTGGGATCATGCCATCGACTTCCCCTCGCGTGCCATGGGTGGCGTCCCTGTTCCACCCTCGCTGATG
AAGACGATGCGTCGCTGTCTGAGTCGCGAGCAGCATCTTCGTCCCACCTGCGCAGAGCTGCTTCTCCCTACCGAC
GGCTTCCTCTATCCTTCCGAGGTGGCCGACGGCGCCCTGGCCGTTGACGAGGAATTACTCGCTCGCCTCGTCCAG
AGCGTCGTCTCTCGGTGTCGCGAGCGTATGCCCTCCGAGGCAGAAGTTCTCGGCGCGTGGCCTCAGGCTTACTGG
GCTAGCATACGCAAAGCTGCTGCGAGCAAGACCTGA
Gene >Ophun1|6461
ATGCGATTCAAGCGCGTCGGCAAGATCCCCGGTAGCTTTCTCAGCGGTCCTGCCCGCCGCGGACGGAGACGACAG
AGTGAGGAGGACGCCGATGGCGATGACGATAACGTCGGGCAGGATGAGCCGCGGCCGGTCGATGACTTTGACGCG
CCGCCACCGTCTCCGCCGGCTCGGTTCGTCGACGGCATCGGGAGCTTCAACTCCGGTAGCCCCGTCGTCGGTAAC
GCCCGGGCCTTGCTGCAGCGGAGGCAGATACCCACGCCGCCGGACGAGGAACCGGTCCTTTTCGCACCGGAGCCG
GCGCCGGAGCACGATCAGGAGAATCTGGTCCCGGGCCGGAGCAAGAGACCGTCGGCTATATCAACCGACCAGCCT
CCTCTCTCACAACCTGCCGCCCTTAAAGCTCTCCCCCAACGATCTTCCACCGACCGCCGACCGCTGGCAGAGCTC
CTCAACAACAGCACGCCTCACCGGGCGCCTCCCCCGCCGCCGCCCAAGATGTCAGTCCTGGAGGCGGCAACAACA
GCGCGAGCCAAGCAGCGACGCAACGTCATCCGCGTCAACGGCAAATGCTACACGCGTCTCGACTGCCTCGGCCGC
GGCGGCAGCGCAAAAGTGTATCGCGTGACGGCTGAGAATGGAAACATGTTTGCGCTGAAGCGTGTTTCGCTCGAT
CACGCTGATGAGACGACGGTCCGGGGCTACAAGGGCGAGATGGAGCTGCTGAATCGACTGGGGGGTGTCGATCGT
GTCATCAAGCTCTTTGACCATGAGCTGAATTCTGAGAAGCAGGTTCTGACCTTGGTGAGCTTCTTCCTTAGGTAT
GCTTTTTGATATCAAGACTGACAGATTTCGTATCAGCTCATGGAACTTGGCGAGCTCGACCTCAACAAGCTCATG
TCTTCCCGCCAGAACCCGGAAAAGGCCCGGTTCGACGCCGTCTTCGTCCGCTTCTACTGGAAAGAGATGGTGGAG
TGTCTGGAAGCCGTCCACCGACACGACATCGTCCACTCCGATCTCAAGCCCGCAAACTTCGTCCTCGTCCGCGGC
CGGCTGAAGCTCATCGACTTTGGCATCGCAAACGCCATCCAGACGGACGAGACTGTCAATGTTCACCGCGAGACG
CAGATTGGCACGCCCAATTACATGTCTCCCGAGTCGCTCATGGACGCCAATAGCGGCGGCCCGCGAGCTGCCAGA
CCGGCTCGGCCGCGGCTCATGAAGCTCGGGAAGCCGAGTGACGTCTGGTCTCTCGGCTGTATTCTGTACCAGATG
GTCTACGGCCTACCGCCCTTTGGCCACATCGCCAACCAGATGGCTCGCTGCCAGGCCATCGTCAACTGGGATCAT
GCCATCGACTTCCCCTCGCGTGCCATGGGTGGCGTCCCTGTTCCACCCTCGCTGATGAAGACGATGCGTCGCTGT
CTGAGTCGCGAGCAGCATCTTCGTCCCACCTGCGCAGAGCTGCTTCTCCCTACCGACGGCTTCCTCTATCCTTCC
GAGGTGGCCGACGGCGCCCTGGCCGTTGACGAGGAATTACTCGCTCGCCTCGTCCAGAGCGTCGTCTCTCGGTGT
CGCGAGCGTATGCCCTCCGAGGCAGAAGTTCTCGGCGCGTGGCCTCAGGCTTACTGGGCTAGCATACGCAAAGCT
GCTGCGAGCAAGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail