Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6458
Gene name
LocationContig_704:1166..3849
Strand-
Gene length (bp)2683
Transcript length (bp)2568
Coding sequence length (bp)2568
Protein length (aa) 856

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07792 Afi1 Docking domain of Afi1 for Arf3 in vesicle trafficking 2.3E-40 102 267
PF08616 SPA Stabilization of polarity axis 2.6E-37 455 564

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5BGR2|MESA_EMENI Protein mesA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mesA PE=1 SV=2 57 835 0.0E+00
sp|O94674|YG76_SCHPO AFI1-like protein C776.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.06c PE=3 SV=2 252 820 3.0E-66
sp|Q99222|AFI1_YEAST ARF3-interacting protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFI1 PE=1 SV=1 75 323 2.0E-11
sp|O94674|YG76_SCHPO AFI1-like protein C776.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.06c PE=3 SV=2 99 153 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6458
MTMALPYLSRHNGRPRRTSLSSILSSRSPSEMSHASRTPQPAVATDTDRTSDPSTKSKTPSFGLSSQHSSLSAPR
RLNADARSTRRLRSQYPRGSPENHVEYILVASFDIDRGPVMEHQYPFAITGDENMLAELMLPDQAHARNQDWTIF
FLHKDISQEEEDEKRRQRERRRRRRRRRRRHHRHLATNEANDGTDARADNDVDGDGDEHDDDDDDEDFDDEHSEG
DDAYHDGDYDDDDDSTDSELDGEGPPLVHVLNLVNTKHDKSVKRGAIVKAMAVCTRHPFLHIYKPLLLLALEEYF
KSPALETLALLYDAVNAMDLSLMPKLSILERSLLLASDNKDLFVEKFELMIQMRLAEDRGEAADDGLDGSSPNRL
AGISRAGTKAHIEGGGHQAMYSVPRDTHEFETKVMYKGIPIPVKVPTAVMPETVGDFSLVKLIQNFSESQAKSPQ
PFPLHPHLTTNGPGTHPIIVLVNALLTQKRVIFLGHNMPSGEVAEAVLAACALVSGGLLRGFTRHAFPYTDLTKI
DDLLNVPGFIAGVTNPTFEHHPEWWDILCDLPSGRVKISSKIEQPPPSEGLVYFQHQNPTLAAVAAGTGGGGGGG
VGSSSSSSQQDLTGDAAFMADVTRSIAARHGERVIRAKWRGWVLKFTRVAAQFEETVYGASALCMGGDDVDPALL
PGASGHGYVWADDAARTKELAGNVTRIEGWRNTRSYYSFIQDLTRMHSLRPLKGLDLAHMHDRLRLQRLTPMQSR
DIYLTFARYVHSYDEICLLLNVAPESHAGLFYLALGLFHKDRDVRVKTAELLDRISVHEAGQHWWKGLSRFERLA
FDRLRRETEAEMRLKLIKEGLSPVLDRRTS*
Coding >Ophun1|6458
ATGACAATGGCCCTTCCCTATCTCTCCCGTCATAACGGCCGTCCTCGCCGAACATCGCTCTCGTCCATCCTCTCG
TCGCGCTCGCCCTCGGAAATGTCACATGCCTCTCGCACGCCGCAGCCGGCCGTGGCCACCGACACGGACCGCACC
TCGGATCCCAGCACAAAGTCCAAGACGCCTTCTTTCGGTCTTTCGTCTCAGCACTCGTCCCTGTCGGCTCCGAGA
CGCCTCAACGCCGATGCCCGCTCTACCCGGAGGCTGCGGTCCCAGTATCCTCGTGGTTCGCCCGAGAACCATGTC
GAGTACATCCTCGTTGCCTCTTTCGACATCGACCGCGGGCCCGTCATGGAGCATCAGTATCCCTTTGCCATCACC
GGTGACGAAAATATGCTGGCCGAGCTGATGCTGCCGGATCAGGCCCACGCCCGCAACCAGGACTGGACCATTTTT
TTCCTGCACAAGGACATCAGTCAGGAGGAAGAGGACGAGAAGCGCCGTCAAAGGGAACGTCGCCGACGCCGGAGA
CGCAGACGCCGGAGGCATCATCGACATCTGGCCACCAATGAGGCCAACGACGGCACCGATGCTCGTGCCGACAAC
GACGTCGACGGTGACGGAGACGAGCATGACGACGACGATGACGACGAAGACTTTGACGACGAACACAGCGAAGGC
GATGACGCCTACCATGATGGCGACTACGATGACGACGACGATTCGACAGACAGCGAGCTCGACGGCGAAGGCCCT
CCATTGGTACACGTCCTGAACCTGGTCAACACCAAGCATGACAAGTCGGTAAAGCGAGGCGCCATCGTCAAGGCC
ATGGCCGTCTGCACGCGGCATCCCTTTCTGCACATATACAAGCCGCTGCTGCTGCTCGCGCTCGAAGAATACTTC
AAGTCGCCGGCGCTCGAGACGCTGGCGCTTCTGTACGACGCCGTCAACGCCATGGACCTGTCGCTAATGCCCAAG
CTCAGCATCCTCGAGAGGAGCCTGCTGCTGGCGAGCGACAATAAGGACCTCTTTGTCGAAAAGTTTGAGCTCATG
ATACAAATGCGTCTGGCCGAGGACCGCGGCGAGGCAGCTGACGATGGCCTCGACGGCAGCAGTCCGAATCGCCTG
GCCGGCATCTCCCGCGCCGGAACCAAGGCGCACATCGAGGGAGGCGGCCACCAGGCCATGTATTCGGTGCCGCGC
GACACGCACGAGTTCGAGACCAAGGTCATGTACAAGGGCATCCCCATTCCCGTCAAGGTGCCGACGGCCGTGATG
CCCGAGACGGTCGGCGACTTTTCTCTCGTCAAGCTCATCCAGAACTTCTCCGAGTCTCAGGCCAAGTCGCCACAG
CCCTTTCCGCTGCACCCTCACCTGACGACCAACGGACCCGGCACGCACCCCATCATAGTGCTCGTCAACGCCCTG
CTCACCCAGAAGCGTGTCATCTTCCTCGGTCACAACATGCCTTCGGGAGAGGTGGCCGAAGCCGTGCTGGCTGCC
TGTGCCCTCGTCTCGGGCGGTCTCCTCCGCGGCTTCACCCGCCACGCCTTTCCCTACACGGACCTGACCAAGATC
GACGACCTCCTCAACGTCCCGGGCTTCATCGCCGGAGTGACGAACCCGACGTTTGAGCACCATCCGGAGTGGTGG
GACATCCTGTGCGACCTGCCCAGCGGCCGCGTCAAGATCAGCTCCAAGATCGAGCAGCCGCCGCCGTCCGAGGGC
CTCGTCTACTTCCAGCACCAGAACCCGACGCTGGCGGCCGTGGCGGCGGGCACCGGCGGCGGAGGCGGAGGCGGA
GTCGGCAGCAGCAGCAGCAGCTCTCAGCAGGACCTCACCGGAGACGCCGCCTTCATGGCCGACGTGACGCGCAGC
ATCGCGGCGAGACACGGCGAGCGCGTCATCCGGGCAAAGTGGCGCGGCTGGGTTCTCAAGTTCACTCGCGTCGCC
GCTCAGTTCGAGGAGACCGTCTACGGAGCCAGCGCCCTCTGTATGGGCGGTGATGATGTCGATCCGGCTCTCCTC
CCCGGCGCCAGTGGCCATGGATACGTTTGGGCCGACGACGCGGCCAGGACCAAGGAGTTGGCTGGCAACGTGACT
CGCATCGAAGGCTGGCGCAATACGCGCAGTTACTATAGCTTCATCCAGGACCTCACCCGAATGCATTCCCTCCGG
CCTCTCAAGGGCCTCGACCTCGCCCACATGCACGACCGTCTCCGGCTCCAGCGGCTGACACCGATGCAGAGCCGA
GACATCTACCTGACGTTCGCGCGGTACGTGCACTCGTATGACGAGATCTGCCTTCTCCTCAACGTCGCGCCCGAG
TCGCACGCTGGGCTGTTCTACCTTGCTCTCGGCCTCTTCCACAAGGACCGCGATGTGCGGGTCAAGACGGCCGAG
CTGCTGGACCGCATCTCGGTGCACGAGGCGGGCCAGCACTGGTGGAAGGGTCTCAGTCGCTTCGAGAGGCTCGCC
TTCGACCGGCTGCGGCGCGAGACCGAGGCCGAGATGCGGCTCAAGCTGATCAAGGAAGGTCTGAGTCCGGTTCTG
GACAGGAGGACCAGCTGA
Transcript >Ophun1|6458
ATGACAATGGCCCTTCCCTATCTCTCCCGTCATAACGGCCGTCCTCGCCGAACATCGCTCTCGTCCATCCTCTCG
TCGCGCTCGCCCTCGGAAATGTCACATGCCTCTCGCACGCCGCAGCCGGCCGTGGCCACCGACACGGACCGCACC
TCGGATCCCAGCACAAAGTCCAAGACGCCTTCTTTCGGTCTTTCGTCTCAGCACTCGTCCCTGTCGGCTCCGAGA
CGCCTCAACGCCGATGCCCGCTCTACCCGGAGGCTGCGGTCCCAGTATCCTCGTGGTTCGCCCGAGAACCATGTC
GAGTACATCCTCGTTGCCTCTTTCGACATCGACCGCGGGCCCGTCATGGAGCATCAGTATCCCTTTGCCATCACC
GGTGACGAAAATATGCTGGCCGAGCTGATGCTGCCGGATCAGGCCCACGCCCGCAACCAGGACTGGACCATTTTT
TTCCTGCACAAGGACATCAGTCAGGAGGAAGAGGACGAGAAGCGCCGTCAAAGGGAACGTCGCCGACGCCGGAGA
CGCAGACGCCGGAGGCATCATCGACATCTGGCCACCAATGAGGCCAACGACGGCACCGATGCTCGTGCCGACAAC
GACGTCGACGGTGACGGAGACGAGCATGACGACGACGATGACGACGAAGACTTTGACGACGAACACAGCGAAGGC
GATGACGCCTACCATGATGGCGACTACGATGACGACGACGATTCGACAGACAGCGAGCTCGACGGCGAAGGCCCT
CCATTGGTACACGTCCTGAACCTGGTCAACACCAAGCATGACAAGTCGGTAAAGCGAGGCGCCATCGTCAAGGCC
ATGGCCGTCTGCACGCGGCATCCCTTTCTGCACATATACAAGCCGCTGCTGCTGCTCGCGCTCGAAGAATACTTC
AAGTCGCCGGCGCTCGAGACGCTGGCGCTTCTGTACGACGCCGTCAACGCCATGGACCTGTCGCTAATGCCCAAG
CTCAGCATCCTCGAGAGGAGCCTGCTGCTGGCGAGCGACAATAAGGACCTCTTTGTCGAAAAGTTTGAGCTCATG
ATACAAATGCGTCTGGCCGAGGACCGCGGCGAGGCAGCTGACGATGGCCTCGACGGCAGCAGTCCGAATCGCCTG
GCCGGCATCTCCCGCGCCGGAACCAAGGCGCACATCGAGGGAGGCGGCCACCAGGCCATGTATTCGGTGCCGCGC
GACACGCACGAGTTCGAGACCAAGGTCATGTACAAGGGCATCCCCATTCCCGTCAAGGTGCCGACGGCCGTGATG
CCCGAGACGGTCGGCGACTTTTCTCTCGTCAAGCTCATCCAGAACTTCTCCGAGTCTCAGGCCAAGTCGCCACAG
CCCTTTCCGCTGCACCCTCACCTGACGACCAACGGACCCGGCACGCACCCCATCATAGTGCTCGTCAACGCCCTG
CTCACCCAGAAGCGTGTCATCTTCCTCGGTCACAACATGCCTTCGGGAGAGGTGGCCGAAGCCGTGCTGGCTGCC
TGTGCCCTCGTCTCGGGCGGTCTCCTCCGCGGCTTCACCCGCCACGCCTTTCCCTACACGGACCTGACCAAGATC
GACGACCTCCTCAACGTCCCGGGCTTCATCGCCGGAGTGACGAACCCGACGTTTGAGCACCATCCGGAGTGGTGG
GACATCCTGTGCGACCTGCCCAGCGGCCGCGTCAAGATCAGCTCCAAGATCGAGCAGCCGCCGCCGTCCGAGGGC
CTCGTCTACTTCCAGCACCAGAACCCGACGCTGGCGGCCGTGGCGGCGGGCACCGGCGGCGGAGGCGGAGGCGGA
GTCGGCAGCAGCAGCAGCAGCTCTCAGCAGGACCTCACCGGAGACGCCGCCTTCATGGCCGACGTGACGCGCAGC
ATCGCGGCGAGACACGGCGAGCGCGTCATCCGGGCAAAGTGGCGCGGCTGGGTTCTCAAGTTCACTCGCGTCGCC
GCTCAGTTCGAGGAGACCGTCTACGGAGCCAGCGCCCTCTGTATGGGCGGTGATGATGTCGATCCGGCTCTCCTC
CCCGGCGCCAGTGGCCATGGATACGTTTGGGCCGACGACGCGGCCAGGACCAAGGAGTTGGCTGGCAACGTGACT
CGCATCGAAGGCTGGCGCAATACGCGCAGTTACTATAGCTTCATCCAGGACCTCACCCGAATGCATTCCCTCCGG
CCTCTCAAGGGCCTCGACCTCGCCCACATGCACGACCGTCTCCGGCTCCAGCGGCTGACACCGATGCAGAGCCGA
GACATCTACCTGACGTTCGCGCGGTACGTGCACTCGTATGACGAGATCTGCCTTCTCCTCAACGTCGCGCCCGAG
TCGCACGCTGGGCTGTTCTACCTTGCTCTCGGCCTCTTCCACAAGGACCGCGATGTGCGGGTCAAGACGGCCGAG
CTGCTGGACCGCATCTCGGTGCACGAGGCGGGCCAGCACTGGTGGAAGGGTCTCAGTCGCTTCGAGAGGCTCGCC
TTCGACCGGCTGCGGCGCGAGACCGAGGCCGAGATGCGGCTCAAGCTGATCAAGGAAGGTCTGAGTCCGGTTCTG
GACAGGAGGACCAGCTGA
Gene >Ophun1|6458
ATGACAATGGCCCTTCCCTATCTCTCCCGTCATAACGGCCGTCCTCGCCGAACATCGCTCTCGTCCATCCTCTCG
TCGCGCTCGCCCTCGGAAATGTCACATGCCTCTCGCACGCCGCAGCCGGCCGTGGCCACCGACACGGACCGCACC
TCGGATCCCAGCACAAAGTCCAAGACGCCTTCTTTCGGTCTTTCGTCTCAGCACTCGTCCCTGTCGGCTCCGAGA
CGCCTCAACGCCGATGCCCGCTCTACCCGGAGGCTGCGGTCCCAGTATCCTCGTGGTTCGCCCGAGAACCATGTC
GAGTACATCCTCGTTGCCTCTTTCGACATCGACCGCGGGCCCGTCATGGAGCATCAGTATCCCTTTGCCATCACC
GGTGACGAAAATATGCTGGCCGAGCTGATGCTGCCGGATCAGGCCCACGCCCGCAACCAGGACTGGACCATTTTT
TTCCTGCACAAGGACATCAGTCAGGAGGAAGAGGACGAGAAGCGCCGTCAAAGGGAACGTCGCCGACGCCGGAGA
CGCAGACGCCGGAGGCATCATCGACATCTGGCCACCAATGAGGCCAACGACGGCACCGATGCTCGTGCCGACAAC
GACGTCGACGGTGACGGAGACGAGCATGACGACGACGATGACGACGAAGACTTTGACGACGAACACAGCGAAGGC
GATGACGCCTACCATGATGGCGACTACGATGACGACGACGATTCGACAGACAGCGAGCTCGACGGCGAAGGCCCT
CCATTGGTACACGTCCTGAACCTGGTCAACACCAAGCATGACAAGTCGGTAAAGCGAGGCGCCATCGTCAAGGCC
ATGGCCGTCTGCACGCGGCATCCCTTTCTGCACATATACAAGGTAAGCCCATCTCGTCTGCTTATCGACTCGACC
ATGACGGCTAACAAGAATCTTAGCCGCTGCTGCTGCTCGCGCTCGAAGAATACTTCAAGTCGCCGGCGCTCGAGA
CGCTGGCGCTTCTGTACGACGCCGTCAACGCCATGGACCTGTCGCTAATGCCCAAGCTCAGCATCCTCGAGAGGA
GCCTGCTGCTGGCGAGCGACAATAAGGACCTCTTTGTCGAAAAGTTTGAGCTCATGATACAAATGCGTCTGGCCG
AGGACCGCGGCGAGGCAGCTGACGATGGCCTCGACGGCAGCAGTCCGAATCGCCTGGCCGGCATCTCCCGCGCCG
GAACCAAGGCGCACATCGAGGGAGGCGGCCACCAGGCCATGTATTCGGTGCCGCGCGACACGCACGAGTTCGAGA
CCAAGGTCATGTACAAGGGCATCCCCATTCCCGTCAAGGTGCCGACGGCCGTGATGCCCGAGACGGTCGGCGACT
TTTCTCTCGTCAAGCTCATCCAGAACTTCTCCGAGTCTCAGGCCAAGTCGCCACAGCCCTTTCCGCTGCACCCTC
ACCTGACGACCAACGGACCCGGCACGCACCCCATCATAGTGCTCGTCAACGCCCTGCTCACCCAGAAGCGTGTCA
TCTTCCTCGGTCACAACATGCCTTCGGGAGAGGTGGCCGAAGCCGTGCTGGCTGCCTGTGCCCTCGTCTCGGGCG
GTCTCCTCCGCGGCTTCACCCGCCACGCCTTTCCCTACACGGACCTGACCAAGATCGACGACCTCCTCAACGTCC
CGGGCTTCATCGCCGGAGTGACGAACCCGACGTTTGAGCACCATCCGGAGTGGTGGGACATCCTGTGCGACCTGC
CCAGCGGCCGCGTCAAGATCAGCTCCAAGATCGAGCAGCCGCCGCCGTCCGAGGGCCTCGTCTACTTCCAGCACC
AGAACCCGACGCTGGCGGCCGTGGCGGCGGGCACCGGCGGCGGAGGCGGAGGCGGAGTCGGCAGCAGCAGCAGCA
GCTCTCAGCAGGACCTCACCGGAGACGCCGCCTTCATGGCCGACGTGACGCGCAGCATCGCGGCGAGACACGGCG
AGCGCGTCATCCGGGCAAAGTGGCGCGGCTGGGTTCTCAAGTTCACTCGCGTCGCCGCTCAGTTCGAGGAGACCG
TCTACGGAGCCAGCGCCCTCTGTATGGGCGGTGATGATGTCGATCCGGCTCTCCTCCCCGGCGCCAGTGGCCATG
GATACGTTTGGGCCGACGACGCGGCCAGGACCAAGGAGTTGGCTGGCAACGTGACTCGCATCGAAGGCTGGCGCA
ATACGCGCAGTTACTATAGCTTCATCCAGGTGAGAGACGGATCATCGAGGAGCGTCTGTCGTGACGTGCTCAACT
GACACACATGCAGGACCTCACCCGAATGCATTCCCTCCGGCCTCTCAAGGGCCTCGACCTCGCCCACATGCACGA
CCGTCTCCGGCTCCAGCGGCTGACACCGATGCAGAGCCGAGACATCTACCTGACGTTCGCGCGGTACGTGCACTC
GTATGACGAGATCTGCCTTCTCCTCAACGTCGCGCCCGAGTCGCACGCTGGGCTGTTCTACCTTGCTCTCGGCCT
CTTCCACAAGGACCGCGATGTGCGGGTCAAGACGGCCGAGCTGCTGGACCGCATCTCGGTGCACGAGGCGGGCCA
GCACTGGTGGAAGGGTCTCAGTCGCTTCGAGAGGCTCGCCTTCGACCGGCTGCGGCGCGAGACCGAGGCCGAGAT
GCGGCTCAAGCTGATCAAGGAAGGTCTGAGTCCGGTTCTGGACAGGAGGACCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail