Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6439
Gene name
LocationContig_70:26329..33383
Strand+
Gene length (bp)7054
Transcript length (bp)6861
Coding sequence length (bp)6861
Protein length (aa) 2287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08326 ACC_central Acetyl-CoA carboxylase, central region 2.1E-275 771 1521
PF01039 Carboxyl_trans Carboxyl transferase domain 7.1E-184 1623 2175
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 9.3E-53 234 416
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 1.4E-27 63 184
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 5.5E-20 460 567
PF00364 Biotin_lipoyl Biotin-requiring enzyme 7.9E-17 705 769

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 32 2280 0.0E+00
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 24 2285 0.0E+00
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 14 2259 0.0E+00
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 14 2259 0.0E+00
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 14 2259 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 32 2280 0.0E+00
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 24 2285 0.0E+00
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 14 2259 0.0E+00
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 14 2259 0.0E+00
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 14 2259 0.0E+00
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 14 2259 0.0E+00
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 14 2259 0.0E+00
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 52 2284 0.0E+00
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 52 2284 0.0E+00
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 52 2277 0.0E+00
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 52 2284 0.0E+00
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 52 2284 0.0E+00
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 52 2284 0.0E+00
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 52 2284 0.0E+00
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 52 2284 0.0E+00
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 49 2285 0.0E+00
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 33 2285 0.0E+00
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 49 2285 0.0E+00
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 48 2210 0.0E+00
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 44 1119 0.0E+00
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 1270 2246 0.0E+00
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 66 568 6.0E-74
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 66 767 3.0E-71
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 62 567 1.0E-69
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 65 767 5.0E-67
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 66 767 2.0E-66
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 63 754 6.0E-64
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 49 580 3.0E-62
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 63 565 7.0E-62
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 65 767 2.0E-61
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 65 767 2.0E-61
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 65 767 2.0E-61
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 54 565 2.0E-61
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 62 567 8.0E-61
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 62 566 1.0E-60
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 62 571 3.0E-60
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 66 565 1.0E-59
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 63 755 3.0E-59
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 66 565 8.0E-59
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 65 566 1.0E-58
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 62 567 4.0E-58
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 62 755 6.0E-58
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 63 565 6.0E-58
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 63 566 2.0E-57
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 62 567 2.0E-56
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 62 567 2.0E-56
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 62 567 5.0E-56
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 66 767 1.0E-55
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 63 565 1.0E-55
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 62 537 2.0E-55
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 63 589 8.0E-55
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 66 767 5.0E-54
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 62 567 2.0E-53
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 66 595 5.0E-53
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 65 565 4.0E-51
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 62 567 2.0E-50
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 63 567 5.0E-50
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 63 567 2.0E-49
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 63 567 3.0E-49
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 63 567 2.0E-48
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 63 567 2.0E-48
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 63 568 1.0E-47
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 63 537 3.0E-47
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 66 595 3.0E-47
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 66 595 8.0E-47
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 63 567 2.0E-46
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 132 595 8.0E-46
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 66 567 5.0E-45
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 66 567 6.0E-45
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 132 595 4.0E-44
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 236 429 5.0E-10
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 239 420 6.0E-10
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 237 418 6.0E-09
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 237 420 7.0E-09
sp|P58939|CARB_CORGL Carbamoyl-phosphate synthase large chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carB PE=3 SV=1 231 420 1.0E-08
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 235 420 1.0E-08
sp|Q4J8E8|CARB_SULAC Carbamoyl-phosphate synthase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carB PE=3 SV=1 237 418 1.0E-08
sp|O67869|CARB1_AQUAE Carbamoyl-phosphate synthase large chain, N-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB1 PE=3 SV=1 233 420 1.0E-08
sp|A4TBY6|CARB_MYCGI Carbamoyl-phosphate synthase large chain OS=Mycobacterium gilvum (strain PYR-GCK) GN=carB PE=3 SV=1 233 420 2.0E-08
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 236 415 3.0E-08
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 237 420 3.0E-08
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 237 420 3.0E-08
sp|Q9ZB63|CARY_GEOSE Carbamoyl-phosphate synthase arginine-specific large chain OS=Geobacillus stearothermophilus GN=carB PE=1 SV=1 235 415 5.0E-08
sp|A1T8H1|CARB_MYCVP Carbamoyl-phosphate synthase large chain OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=carB PE=3 SV=1 233 420 6.0E-08
sp|Q8CPJ4|CARB_STAES Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carB PE=3 SV=1 236 418 8.0E-08
sp|P9WQH6|PCC5_MYCTO Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD5 PE=3 SV=1 1737 2083 8.0E-08
sp|Q49WY4|CARB_STAS1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carB PE=3 SV=1 236 429 1.0E-07
sp|Q9KXR6|CARB_STRCO Carbamoyl-phosphate synthase large chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=carB PE=3 SV=1 233 424 1.0E-07
sp|Q827Q7|CARB_STRAW Carbamoyl-phosphate synthase large chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=carB PE=3 SV=1 233 424 1.0E-07
sp|B9DPN2|CARB_STACT Carbamoyl-phosphate synthase large chain OS=Staphylococcus carnosus (strain TM300) GN=carB PE=3 SV=1 236 409 1.0E-07
sp|P9WPK3|CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carB PE=1 SV=1 205 424 2.0E-07
sp|P9WPK2|CARB_MYCTO Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carB PE=3 SV=1 205 424 2.0E-07
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 235 424 2.0E-07
sp|Q7VP67|CARB_HAEDU Carbamoyl-phosphate synthase large chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=carB PE=3 SV=1 237 420 2.0E-07
sp|Q2YXG5|CARB_STAAB Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|A8Z3P0|CARB_STAAT Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|Q6GA10|CARB_STAAS Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MSSA476) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|A6QGA4|CARB_STAAE Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Newman) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|Q5HGM9|CARB_STAAC Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain COL) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|Q2FZ72|CARB_STAA8 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain NCTC 8325) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|Q2FHN5|CARB_STAA3 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|P63740|CARB_STAAN Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain N315) GN=carB PE=1 SV=1 236 434 2.0E-07
sp|P63739|CARB_STAAM Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|A5IS88|CARB_STAA9 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH9) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|A6U122|CARB_STAA2 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH1) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|A7X1F4|CARB_STAA1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|Q6GHN2|CARB_STAAR Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MRSA252) GN=carB PE=3 SV=1 236 434 2.0E-07
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 237 420 3.0E-07
sp|B2GI87|CARB_KOCRD Carbamoyl-phosphate synthase large chain OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=carB PE=3 SV=1 233 419 3.0E-07
sp|Q7U054|CARB_MYCBO Carbamoyl-phosphate synthase large chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carB PE=3 SV=1 205 424 3.0E-07
sp|Q5HPY8|CARB_STAEQ Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carB PE=3 SV=1 236 415 3.0E-07
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 233 420 4.0E-07
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 233 420 4.0E-07
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 233 420 4.0E-07
sp|Q8FT42|CARB_COREF Carbamoyl-phosphate synthase large chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carB PE=3 SV=1 205 419 5.0E-07
sp|P9WQH7|PCC5_MYCTU Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD5 PE=1 SV=1 1737 2083 5.0E-07
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 237 428 6.0E-07
sp|Q9PIL7|CARB_CAMJE Carbamoyl-phosphate synthase large chain OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=carB PE=3 SV=1 225 420 6.0E-07
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 237 428 8.0E-07
sp|B8H8U5|CARB_ARTCA Carbamoyl-phosphate synthase large chain OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=carB PE=3 SV=1 196 419 8.0E-07
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 235 418 9.0E-07
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 231 418 1.0E-06
sp|A8F453|CARB_PSELT Carbamoyl-phosphate synthase large chain OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=carB PE=3 SV=1 228 418 1.0E-06
sp|C5CCF1|CARB_MICLC Carbamoyl-phosphate synthase large chain OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=carB PE=3 SV=1 233 424 1.0E-06
sp|Q9JXW8|CARB_NEIMB Carbamoyl-phosphate synthase large chain OS=Neisseria meningitidis serogroup B (strain MC58) GN=carB PE=3 SV=1 237 420 1.0E-06
sp|Q1AVY9|CARB_RUBXD Carbamoyl-phosphate synthase large chain OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=carB PE=3 SV=1 235 418 1.0E-06
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 211 412 1.0E-06
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 245 420 1.0E-06
sp|P58940|CARB_STAAW Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MW2) GN=carB PE=3 SV=1 236 434 1.0E-06
sp|A5IJL8|CARB_THEP1 Carbamoyl-phosphate synthase large chain OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=carB PE=3 SV=1 234 418 1.0E-06
sp|Q9WZ27|CARB_THEMA Carbamoyl-phosphate synthase large chain OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=carB PE=3 SV=1 234 418 1.0E-06
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 233 418 2.0E-06
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 233 420 2.0E-06
sp|A1R6Z3|CARB_ARTAT Carbamoyl-phosphate synthase large chain OS=Arthrobacter aurescens (strain TC1) GN=carB PE=3 SV=1 196 419 2.0E-06
sp|B1W463|CARB_STRGG Carbamoyl-phosphate synthase large chain OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=carB PE=3 SV=1 233 424 2.0E-06
sp|B9KB91|CARB_THENN Carbamoyl-phosphate synthase large chain OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=carB PE=3 SV=1 234 418 3.0E-06
sp|B1L8T8|CARB_THESQ Carbamoyl-phosphate synthase large chain OS=Thermotoga sp. (strain RQ2) GN=carB PE=3 SV=1 234 418 3.0E-06
sp|Q0TM79|CARB_CLOP1 Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=carB PE=3 SV=1 235 427 4.0E-06
sp|C3MW21|CARB_SULIM Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=carB PE=3 SV=1 237 418 5.0E-06
sp|C3N664|CARB_SULIA Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.27) GN=carB PE=3 SV=1 237 418 5.0E-06
sp|Q9JW02|CARB_NEIMA Carbamoyl-phosphate synthase large chain OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=carB PE=3 SV=1 237 420 5.0E-06
sp|C4KHM7|CARB_SULIK Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=carB PE=3 SV=1 237 418 5.0E-06
sp|A9WSA8|CARB_RENSM Carbamoyl-phosphate synthase large chain OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=carB PE=3 SV=1 233 419 5.0E-06
sp|A0JX72|CARB_ARTS2 Carbamoyl-phosphate synthase large chain OS=Arthrobacter sp. (strain FB24) GN=carB PE=3 SV=1 196 419 5.0E-06
sp|B9KB91|CARB_THENN Carbamoyl-phosphate synthase large chain OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=carB PE=3 SV=1 233 414 6.0E-06
sp|Q8K9Z7|CARB_BUCAP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carB PE=3 SV=3 233 432 6.0E-06
sp|C3NEM0|CARB_SULIY Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=carB PE=3 SV=1 237 418 6.0E-06
sp|C3MQE3|CARB_SULIL Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=carB PE=3 SV=1 237 418 6.0E-06
sp|C3NH23|CARB_SULIN Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=carB PE=3 SV=1 237 418 6.0E-06
sp|A5IJL8|CARB_THEP1 Carbamoyl-phosphate synthase large chain OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=carB PE=3 SV=1 233 414 7.0E-06
sp|Q9WZ27|CARB_THEMA Carbamoyl-phosphate synthase large chain OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=carB PE=3 SV=1 233 414 7.0E-06
sp|B1L8T8|CARB_THESQ Carbamoyl-phosphate synthase large chain OS=Thermotoga sp. (strain RQ2) GN=carB PE=3 SV=1 233 414 7.0E-06
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 233 415 7.0E-06
sp|Q9CKV0|CARB_PASMU Carbamoyl-phosphate synthase large chain OS=Pasteurella multocida (strain Pm70) GN=carB PE=3 SV=1 237 420 8.0E-06
sp|Q59969|CARB_SULSO Carbamoyl-phosphate synthase large chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carB PE=3 SV=1 237 418 9.0E-06
sp|Q9CCR2|CARB_MYCLE Carbamoyl-phosphate synthase large chain OS=Mycobacterium leprae (strain TN) GN=carB PE=3 SV=2 205 419 9.0E-06
sp|Q0SPY4|CARB_CLOPS Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain SM101 / Type A) GN=carB PE=3 SV=1 235 427 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006633 fatty acid biosynthetic process Yes
GO:0003989 acetyl-CoA carboxylase activity Yes
GO:0005524 ATP binding Yes
GO:0009058 biosynthetic process No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019752 carboxylic acid metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0017076 purine nucleotide binding No
GO:0016053 organic acid biosynthetic process No
GO:0016421 CoA carboxylase activity No
GO:0000166 nucleotide binding No
GO:0016885 ligase activity, forming carbon-carbon bonds No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006631 fatty acid metabolic process No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6439
MVSATPVATNGTNGRTVPVSNGKASYAEKHAVADHFIGGNALANAPAGKVKDFVAQNDGHTVITNVLIANNGIAA
VKEIRSVRKWAYETFGDERAIHFTVMATPEDLQANADYIRMADHYVEVPGGTNNHNYANVELIVDIAERMNVHAV
WAGWGHASENPKLPESLAASPNKIVFIGPPGSAMRSLGDKISSTIVAQHALVPCIPWSGTGVNAVDIDAKGIVTV
PDDVYAKGCVTSWQEGLEKAKEIGFPVMIKASEGGGGKGIRKATNEDEFEALYKAAASEIPGSPIFIMKLAGNAR
HLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKADTFKAMEDAAVRLGKLVGYVSAGTVEYLYSHAD
DKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGLPLHRVRDIRLLYGVDPKASSLIDFEFKQHGTAQSQRR
PTPTGHTTACRITSEDPGEGFKPSNGVMHELNFRSSSNVWGYFSVGTQGGIHSFSDSQFGHIFAYGENRQASRKH
MVVALKELSIRGDFRTTVEYLIKLLETEDFEENTISTGWLDELISKRLTAERPDPMLAVVCGATTKAHIASEACL
AEYRAGLEKGQVPSKEILKTVFTIDFIYEGFRYKFTATRASADSYHLFINGSKCSVGVRALSDGGLLILLDGHSH
NVYWKEEVGATRLSVDSKTCLLEQENDPTQLRSPSPGKLVKYTVENGAHVKAGQTFAEVEVMKMYMPLIAQEDGI
VQLIKQPGATLEAGDILGILALDDPSRVKQAQAFVDKLPAYGEPVVVGNKPAQRFSVLRDIITNIHMGYDNSVIM
APALKELIEVLRNPELPYSEWNACFSALHARMPQKLDAQLVQVVERAKARHAEFPARTLIKALHKFMEESVADAD
VDLLKVTLAPLLEILTQYADGQKVRELNFIDRLLETYWDVEKLFVGQVQEDAVVLKLRDQNKDNINKVLQIVLSH
SRVSAKSSLMLAILDEYRPNRPNVGNIGKYLRDSLRKLTELSSRPTSKVSLKAREIMIQCSLPSLEERTAQLEHI
LRSSVVESRYGESGWDHREPNLDVIKEVVDSKYTVFDVLPLFFAHEDPWVALASLEVYVRRSYRAYVLQQIEYHN
DESDLPLFVSWDFQLRKLGQSEFGLPLMSAAPSTPGTPVTPVNSRPFMNRISSISDMSYLNSKWDEEPTRKGIIA
PCRYLDDAEDMIQKALETLAVHNKQKKLNNGTNILAELNGKRKPSSVLKHDVRKGDELSAVINIAVRDAETRDDG
EIMSRILPVVEQFKSDMLARGVRRLTFICGHSDGGYPGYYTFRGPEYNEDDSIRHSEPALAFQLELGRLAKFGIK
PVFTQNKNIHVYEAVGKAVDTDKRYFTRAVIRPGRLRDEIPTAEYLISEADRVINDIFDALEIIGNNSSDLNHIF
MNFTPVFQLDPQQVEKSLQGFLDRFGPRGWRLRVSQVEIRIICTDPTTSTPYPLRVVVTNTSGYIVDVDMYAERK
SEKGEWLFHSIGGTKEKGPLHLLSVSTPYATKNALQPKRYKAHLMGTQYVYDFPELFRQAIQNSWAKAVQNQPAL
ASQRPKVGECITFTELVLDEQDNIDEVNREPGTNTCGMVGWIFRARTPEYPAGRRFVVIANDITYKIGSFGPKED
NFFHKCTELARRLGIPRIYLSANSGARLGLAEELIPHFKVAWNDPEKPEAGFRYLYLDDKTRQGFKKDVITEEIS
EGGEKRHRIVTIVGQEDGLGVECLKGSGLIAGATSRAYEEIFTVTLVTCRSVGIGAYLVRLGQRAVQIEGQPIIL
TGAPALNNLLGREVYTSNLQLGGTQIMYRNGVSHMTANDDFAGISRIVEWMSFVPEKRNGPVPISPSVDDWNRDV
TYCPPQKQPYDVRWMIAGKEDEDGGFLSGLFDKDSFVEALGGWARTVVVGRARLGGIPMGVIAVETRSVENITPA
DPANPDSMEQVSNEAGGVWYPNSAFKTAQAINDFNKGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVK
FEQPIFVYVPPFGELRGGSWVVVDPTINPTVMEMYADVEARGGVLEPEGMIGIKYRKEKQLETMARLDPIYAGFK
RRLEDKSLSAEEAAEVKSKMTIREKMLLPVYAQVAVQFADLHDRAGRMKAKGAIRDSLSWINARRFFYWRLRRRL
NEEYILKRMANKDANNNQAKAAEARARNMLLLESWSGITGWGHNDREVAEWYEKERKSIGDKVEALKAEKVSAEV
SEAVRSHKDAGWKGVREVLRVMPPEEREAMLKYLKG*
Coding >Ophun1|6439
ATGGTGTCAGCGACGCCTGTCGCCACAAACGGCACCAATGGTCGCACCGTTCCCGTCTCCAACGGAAAGGCGTCC
TACGCCGAGAAGCACGCCGTTGCTGACCACTTCATCGGAGGCAACGCTCTGGCCAATGCCCCGGCCGGCAAGGTC
AAGGACTTTGTCGCCCAAAACGATGGCCACACCGTCATCACAAACGTCCTCATAGCAAATAACGGAATCGCCGCC
GTCAAGGAGATCCGCTCCGTCCGAAAATGGGCGTACGAGACGTTTGGCGACGAGCGTGCCATTCATTTCACCGTC
ATGGCCACCCCTGAGGATCTTCAGGCCAACGCAGACTACATTCGCATGGCCGATCACTACGTCGAGGTCCCGGGC
GGCACCAACAACCACAACTACGCCAACGTGGAGCTGATAGTTGATATTGCCGAGCGGATGAATGTCCATGCCGTC
TGGGCTGGCTGGGGCCACGCCTCCGAGAACCCCAAGCTGCCAGAGTCGCTGGCTGCCTCTCCCAATAAGATCGTC
TTCATCGGACCCCCGGGATCCGCCATGAGGTCTCTGGGCGACAAAATATCGTCCACCATCGTTGCCCAGCACGCC
CTCGTCCCCTGCATACCATGGTCCGGCACGGGTGTCAACGCCGTCGACATCGACGCAAAGGGCATCGTCACCGTC
CCAGATGACGTCTACGCCAAGGGCTGCGTCACTTCATGGCAGGAAGGCCTGGAAAAGGCAAAGGAGATTGGCTTC
CCCGTCATGATCAAAGCCTCAGAGGGTGGCGGCGGTAAGGGCATCCGCAAAGCCACCAACGAGGACGAGTTCGAG
GCCCTGTACAAGGCGGCAGCCAGCGAGATCCCGGGCTCGCCCATCTTCATTATGAAGCTGGCCGGCAATGCCCGT
CATCTCGAAGTCCAGTTGTTGGCTGACCAGTATGGCAACAACATCTCCCTGTTTGGCCGTGACTGCTCCGTCCAG
CGGCGTCACCAGAAGATTATCGAGGAGGCGCCCGTCACCATCGCAAAGGCTGACACCTTCAAGGCCATGGAAGAT
GCCGCCGTCCGGCTGGGCAAGCTGGTTGGCTATGTCTCGGCCGGCACCGTCGAATATCTATACTCGCACGCCGAC
GACAAATTCTACTTCCTCGAGCTCAACCCGCGTCTTCAGGTCGAGCATCCGACGACGGAAATGGTCAGCGGCGTC
AACCTGCCCGCAGCTCAGCTTCAGATCGCCATGGGCTTGCCACTGCACCGTGTCCGCGATATCAGGCTGCTTTAC
GGCGTCGACCCCAAGGCCTCGAGCCTCATCGACTTCGAGTTCAAGCAGCACGGCACCGCTCAGTCCCAGCGCCGC
CCGACGCCCACCGGCCACACGACCGCCTGCCGCATTACCTCGGAGGACCCGGGCGAGGGCTTCAAGCCGTCCAAC
GGCGTCATGCACGAGCTCAACTTCAGGAGCAGCTCCAATGTCTGGGGCTACTTCTCCGTCGGCACCCAGGGTGGT
ATCCACAGCTTCTCCGACAGCCAGTTCGGCCATATATTCGCCTACGGCGAGAATCGCCAGGCCTCGCGTAAGCAC
ATGGTCGTGGCCCTCAAGGAACTCAGCATCCGCGGCGACTTTCGAACCACTGTCGAGTACCTCATCAAGCTGCTC
GAGACGGAAGACTTTGAGGAGAATACCATCTCGACCGGCTGGCTCGACGAGCTCATCTCCAAGCGGCTGACCGCT
GAGCGTCCGGACCCCATGCTCGCCGTCGTCTGCGGTGCCACCACAAAGGCCCACATCGCCAGCGAAGCATGCCTG
GCCGAGTATCGAGCCGGCCTCGAAAAGGGTCAGGTGCCGTCCAAGGAGATACTCAAGACAGTCTTCACCATCGAC
TTCATCTACGAGGGCTTCCGCTACAAGTTTACAGCCACCCGCGCCAGCGCCGACAGCTACCACCTCTTCATCAAC
GGCTCCAAGTGCTCTGTAGGCGTCCGCGCCCTCAGCGACGGTGGCCTGCTCATCCTCCTGGACGGCCACAGCCAC
AATGTCTACTGGAAGGAAGAGGTCGGCGCCACCCGTCTCTCAGTTGACAGCAAGACGTGTCTCCTCGAGCAGGAA
AACGATCCGACACAACTGCGGTCCCCCAGCCCCGGCAAGCTCGTCAAGTACACGGTCGAGAACGGGGCTCACGTC
AAGGCCGGCCAGACGTTCGCCGAGGTCGAGGTCATGAAGATGTACATGCCTCTCATTGCCCAGGAGGACGGCATT
GTCCAGCTCATCAAGCAGCCTGGCGCCACCCTCGAGGCTGGCGACATCCTCGGCATCCTCGCCCTCGACGATCCC
AGCCGCGTGAAGCAGGCCCAGGCCTTCGTCGACAAACTCCCGGCCTACGGGGAGCCCGTCGTCGTCGGCAACAAG
CCCGCTCAGCGCTTCAGCGTCCTGCGCGACATCATCACCAACATCCACATGGGCTACGACAACTCGGTCATCATG
GCGCCCGCTCTCAAGGAGCTCATCGAGGTGCTACGGAACCCGGAGCTGCCATACAGCGAGTGGAACGCTTGCTTT
TCTGCCCTGCACGCGCGCATGCCCCAGAAGCTCGACGCTCAGCTGGTCCAGGTTGTCGAGCGCGCGAAGGCGCGT
CATGCCGAGTTCCCGGCCAGGACCCTCATCAAGGCTCTGCACAAGTTCATGGAGGAGAGCGTGGCCGACGCCGAC
GTCGATCTGCTCAAGGTGACGCTCGCGCCCTTGCTGGAGATCTTGACGCAGTACGCCGACGGCCAAAAGGTCCGC
GAACTCAACTTCATCGACAGGTTGCTGGAGACATATTGGGACGTCGAGAAGCTCTTCGTCGGCCAGGTGCAAGAG
GATGCCGTCGTTCTCAAGCTGCGCGACCAGAACAAGGACAATATCAACAAGGTGCTCCAGATCGTGCTCTCGCAC
AGCCGAGTCAGCGCAAAGAGCTCTCTCATGCTCGCCATCCTCGACGAGTACCGCCCCAACAGGCCCAACGTCGGC
AACATTGGCAAATACCTGCGCGACTCGCTTCGCAAGCTGACGGAGCTCTCGTCGCGGCCCACGTCCAAGGTGTCT
CTCAAGGCCCGCGAGATCATGATCCAGTGCTCGCTCCCGTCGCTGGAGGAGCGGACCGCCCAGCTGGAGCACATC
CTCCGCTCGTCAGTGGTCGAATCGCGCTACGGCGAGAGCGGCTGGGACCACCGCGAGCCCAACCTCGATGTCATC
AAAGAGGTGGTCGACTCCAAGTACACCGTCTTTGACGTGCTCCCGCTCTTCTTCGCCCACGAGGATCCGTGGGTG
GCGCTGGCGTCTCTGGAGGTCTACGTCCGTCGCTCGTATCGCGCCTACGTGCTGCAGCAGATCGAGTACCACAAC
GACGAGTCGGATCTGCCCCTTTTCGTCTCATGGGATTTCCAGCTTCGCAAGCTGGGCCAGTCCGAGTTTGGCCTG
CCGCTCATGTCGGCCGCGCCCTCGACGCCCGGCACGCCCGTGACTCCCGTCAACTCGAGGCCTTTCATGAACCGC
ATCTCGTCCATCAGCGACATGTCGTACCTCAACAGCAAGTGGGACGAAGAGCCGACACGCAAGGGCATCATCGCG
CCCTGCAGGTATCTCGACGACGCCGAGGACATGATCCAGAAGGCACTCGAGACCCTCGCAGTCCACAACAAGCAG
AAGAAGCTCAACAACGGCACCAATATCCTGGCCGAGCTCAACGGCAAGCGCAAGCCCTCGTCGGTCTTGAAGCAC
GATGTCAGGAAGGGTGACGAGCTGTCGGCCGTCATCAACATCGCCGTGCGCGACGCCGAGACGCGTGACGATGGG
GAGATCATGTCTCGCATCCTGCCCGTCGTCGAGCAGTTCAAGAGCGACATGCTCGCGCGCGGCGTCCGACGCCTC
ACCTTCATCTGCGGCCACAGCGACGGCGGGTATCCCGGCTACTACACGTTCCGCGGCCCCGAGTACAACGAGGAC
GACAGCATCCGTCACAGCGAGCCGGCCCTGGCTTTCCAGCTCGAGCTGGGACGCCTGGCAAAGTTCGGCATCAAG
CCCGTCTTCACGCAGAACAAGAACATCCACGTGTACGAGGCCGTCGGAAAGGCCGTCGATACTGATAAGCGCTAC
TTCACCCGCGCCGTGATCCGACCCGGACGTCTGCGCGACGAGATCCCAACGGCCGAGTACCTCATCTCCGAGGCG
GACCGCGTCATCAACGACATCTTTGACGCGCTCGAGATCATCGGCAACAACTCGTCGGATCTGAATCACATCTTT
ATGAACTTCACGCCCGTCTTCCAACTGGACCCGCAGCAGGTCGAGAAGAGCCTGCAGGGTTTCCTGGACCGCTTC
GGTCCCCGGGGCTGGCGGCTGCGCGTGTCGCAGGTCGAGATCCGCATCATCTGTACGGATCCGACGACCAGCACG
CCCTATCCCCTCCGCGTCGTCGTCACCAACACGTCGGGCTACATTGTCGACGTCGACATGTACGCCGAGCGAAAG
TCGGAGAAGGGCGAGTGGCTCTTCCACAGCATCGGCGGCACCAAGGAGAAGGGCCCGCTGCATCTGCTGTCCGTC
TCGACGCCCTACGCGACCAAGAACGCCCTCCAGCCGAAGCGCTACAAGGCGCATCTCATGGGCACGCAGTACGTC
TACGACTTCCCCGAGCTCTTCCGCCAGGCGATCCAGAACAGCTGGGCCAAGGCGGTACAGAATCAGCCCGCGCTG
GCGTCGCAGCGGCCCAAGGTCGGCGAGTGCATCACCTTTACCGAGCTGGTCCTCGACGAACAGGACAACATCGAC
GAGGTCAACCGCGAGCCCGGCACCAACACCTGCGGCATGGTCGGCTGGATCTTCCGGGCGCGCACCCCTGAGTAC
CCGGCCGGGCGGCGCTTCGTCGTCATCGCCAACGACATCACGTACAAAATCGGGTCTTTTGGGCCCAAGGAAGAC
AACTTCTTCCACAAGTGTACCGAGCTCGCCCGTAGGCTGGGCATCCCACGCATCTATCTGTCGGCCAACTCGGGC
GCGCGTCTGGGCCTGGCTGAGGAGCTGATCCCGCACTTCAAGGTGGCCTGGAACGACCCGGAGAAGCCCGAGGCC
GGGTTCCGCTACCTGTACCTCGACGACAAGACGAGGCAGGGCTTCAAGAAGGACGTCATCACCGAGGAGATTTCC
GAGGGAGGCGAGAAGCGCCACCGCATCGTCACCATTGTCGGTCAGGAGGACGGGCTCGGCGTCGAGTGCCTCAAA
GGGTCTGGTCTCATTGCCGGCGCGACTAGTCGGGCCTATGAGGAGATCTTTACGGTGACGCTGGTGACTTGCCGG
TCTGTTGGAATCGGCGCCTATCTCGTGCGCCTCGGTCAGCGAGCCGTGCAGATTGAAGGCCAGCCCATCATCCTG
ACGGGCGCCCCGGCCCTCAACAACCTGCTTGGTCGCGAAGTGTACACGTCGAATCTGCAGCTCGGCGGCACGCAG
ATCATGTACCGCAACGGTGTCTCCCACATGACGGCCAACGACGACTTTGCCGGCATCTCACGCATCGTCGAATGG
ATGTCGTTTGTGCCGGAGAAGCGCAATGGCCCTGTGCCCATCAGTCCGAGCGTCGATGACTGGAACCGCGACGTG
ACGTACTGCCCGCCGCAGAAGCAGCCGTACGACGTGCGGTGGATGATTGCCGGCAAAGAGGATGAGGACGGCGGC
TTCCTCAGCGGCCTCTTCGACAAGGACTCGTTCGTCGAGGCGCTCGGGGGCTGGGCGCGAACGGTTGTGGTGGGC
CGGGCGCGTCTGGGGGGCATCCCCATGGGCGTCATCGCCGTCGAGACGCGGTCGGTGGAGAACATTACGCCGGCC
GACCCGGCCAATCCGGACTCGATGGAGCAGGTGAGCAACGAGGCCGGCGGCGTGTGGTATCCCAACTCGGCCTTC
AAGACGGCGCAGGCCATCAACGACTTCAACAAGGGCGAGCAGCTGCCGTTGATGATTCTGGCCAACTGGCGCGGC
TTCTCGGGCGGGCAGCGCGACATGTACAACGAGGTACTCAAGTACGGGTCCTTCATCGTCGACGCGCTCGTCAAG
TTTGAGCAGCCCATCTTTGTGTACGTGCCGCCGTTTGGCGAGCTACGAGGCGGTTCGTGGGTTGTCGTCGACCCG
ACCATCAACCCGACCGTCATGGAGATGTACGCCGACGTCGAGGCGCGGGGTGGCGTGTTGGAGCCTGAAGGCATG
ATCGGCATCAAATACCGCAAGGAAAAGCAGCTGGAGACGATGGCGCGCCTGGACCCGATCTACGCCGGCTTCAAG
CGGCGACTGGAAGACAAGAGCCTGAGCGCCGAAGAGGCGGCCGAGGTCAAGTCGAAGATGACGATACGGGAAAAG
ATGCTGCTGCCGGTATACGCACAGGTGGCGGTGCAGTTTGCGGATCTGCACGACCGGGCCGGGCGGATGAAGGCC
AAGGGCGCGATCCGGGACTCGCTGTCTTGGATCAACGCCCGCCGCTTCTTCTACTGGCGGTTGCGACGACGGCTC
AACGAGGAGTATATCCTGAAGCGCATGGCGAACAAGGACGCCAACAACAACCAGGCCAAGGCGGCCGAGGCGCGG
GCGCGGAATATGCTGTTGCTGGAGAGCTGGTCGGGCATCACGGGCTGGGGACACAACGACCGCGAGGTGGCCGAA
TGGTACGAGAAGGAGCGAAAGTCGATTGGCGATAAGGTGGAGGCACTCAAGGCTGAGAAGGTGTCGGCCGAGGTG
TCGGAGGCGGTGCGCAGCCACAAGGACGCTGGATGGAAGGGGGTGCGCGAGGTGCTGAGGGTGATGCCGCCGGAG
GAGCGTGAGGCGATGCTCAAGTATCTCAAGGGGTGA
Transcript >Ophun1|6439
ATGGTGTCAGCGACGCCTGTCGCCACAAACGGCACCAATGGTCGCACCGTTCCCGTCTCCAACGGAAAGGCGTCC
TACGCCGAGAAGCACGCCGTTGCTGACCACTTCATCGGAGGCAACGCTCTGGCCAATGCCCCGGCCGGCAAGGTC
AAGGACTTTGTCGCCCAAAACGATGGCCACACCGTCATCACAAACGTCCTCATAGCAAATAACGGAATCGCCGCC
GTCAAGGAGATCCGCTCCGTCCGAAAATGGGCGTACGAGACGTTTGGCGACGAGCGTGCCATTCATTTCACCGTC
ATGGCCACCCCTGAGGATCTTCAGGCCAACGCAGACTACATTCGCATGGCCGATCACTACGTCGAGGTCCCGGGC
GGCACCAACAACCACAACTACGCCAACGTGGAGCTGATAGTTGATATTGCCGAGCGGATGAATGTCCATGCCGTC
TGGGCTGGCTGGGGCCACGCCTCCGAGAACCCCAAGCTGCCAGAGTCGCTGGCTGCCTCTCCCAATAAGATCGTC
TTCATCGGACCCCCGGGATCCGCCATGAGGTCTCTGGGCGACAAAATATCGTCCACCATCGTTGCCCAGCACGCC
CTCGTCCCCTGCATACCATGGTCCGGCACGGGTGTCAACGCCGTCGACATCGACGCAAAGGGCATCGTCACCGTC
CCAGATGACGTCTACGCCAAGGGCTGCGTCACTTCATGGCAGGAAGGCCTGGAAAAGGCAAAGGAGATTGGCTTC
CCCGTCATGATCAAAGCCTCAGAGGGTGGCGGCGGTAAGGGCATCCGCAAAGCCACCAACGAGGACGAGTTCGAG
GCCCTGTACAAGGCGGCAGCCAGCGAGATCCCGGGCTCGCCCATCTTCATTATGAAGCTGGCCGGCAATGCCCGT
CATCTCGAAGTCCAGTTGTTGGCTGACCAGTATGGCAACAACATCTCCCTGTTTGGCCGTGACTGCTCCGTCCAG
CGGCGTCACCAGAAGATTATCGAGGAGGCGCCCGTCACCATCGCAAAGGCTGACACCTTCAAGGCCATGGAAGAT
GCCGCCGTCCGGCTGGGCAAGCTGGTTGGCTATGTCTCGGCCGGCACCGTCGAATATCTATACTCGCACGCCGAC
GACAAATTCTACTTCCTCGAGCTCAACCCGCGTCTTCAGGTCGAGCATCCGACGACGGAAATGGTCAGCGGCGTC
AACCTGCCCGCAGCTCAGCTTCAGATCGCCATGGGCTTGCCACTGCACCGTGTCCGCGATATCAGGCTGCTTTAC
GGCGTCGACCCCAAGGCCTCGAGCCTCATCGACTTCGAGTTCAAGCAGCACGGCACCGCTCAGTCCCAGCGCCGC
CCGACGCCCACCGGCCACACGACCGCCTGCCGCATTACCTCGGAGGACCCGGGCGAGGGCTTCAAGCCGTCCAAC
GGCGTCATGCACGAGCTCAACTTCAGGAGCAGCTCCAATGTCTGGGGCTACTTCTCCGTCGGCACCCAGGGTGGT
ATCCACAGCTTCTCCGACAGCCAGTTCGGCCATATATTCGCCTACGGCGAGAATCGCCAGGCCTCGCGTAAGCAC
ATGGTCGTGGCCCTCAAGGAACTCAGCATCCGCGGCGACTTTCGAACCACTGTCGAGTACCTCATCAAGCTGCTC
GAGACGGAAGACTTTGAGGAGAATACCATCTCGACCGGCTGGCTCGACGAGCTCATCTCCAAGCGGCTGACCGCT
GAGCGTCCGGACCCCATGCTCGCCGTCGTCTGCGGTGCCACCACAAAGGCCCACATCGCCAGCGAAGCATGCCTG
GCCGAGTATCGAGCCGGCCTCGAAAAGGGTCAGGTGCCGTCCAAGGAGATACTCAAGACAGTCTTCACCATCGAC
TTCATCTACGAGGGCTTCCGCTACAAGTTTACAGCCACCCGCGCCAGCGCCGACAGCTACCACCTCTTCATCAAC
GGCTCCAAGTGCTCTGTAGGCGTCCGCGCCCTCAGCGACGGTGGCCTGCTCATCCTCCTGGACGGCCACAGCCAC
AATGTCTACTGGAAGGAAGAGGTCGGCGCCACCCGTCTCTCAGTTGACAGCAAGACGTGTCTCCTCGAGCAGGAA
AACGATCCGACACAACTGCGGTCCCCCAGCCCCGGCAAGCTCGTCAAGTACACGGTCGAGAACGGGGCTCACGTC
AAGGCCGGCCAGACGTTCGCCGAGGTCGAGGTCATGAAGATGTACATGCCTCTCATTGCCCAGGAGGACGGCATT
GTCCAGCTCATCAAGCAGCCTGGCGCCACCCTCGAGGCTGGCGACATCCTCGGCATCCTCGCCCTCGACGATCCC
AGCCGCGTGAAGCAGGCCCAGGCCTTCGTCGACAAACTCCCGGCCTACGGGGAGCCCGTCGTCGTCGGCAACAAG
CCCGCTCAGCGCTTCAGCGTCCTGCGCGACATCATCACCAACATCCACATGGGCTACGACAACTCGGTCATCATG
GCGCCCGCTCTCAAGGAGCTCATCGAGGTGCTACGGAACCCGGAGCTGCCATACAGCGAGTGGAACGCTTGCTTT
TCTGCCCTGCACGCGCGCATGCCCCAGAAGCTCGACGCTCAGCTGGTCCAGGTTGTCGAGCGCGCGAAGGCGCGT
CATGCCGAGTTCCCGGCCAGGACCCTCATCAAGGCTCTGCACAAGTTCATGGAGGAGAGCGTGGCCGACGCCGAC
GTCGATCTGCTCAAGGTGACGCTCGCGCCCTTGCTGGAGATCTTGACGCAGTACGCCGACGGCCAAAAGGTCCGC
GAACTCAACTTCATCGACAGGTTGCTGGAGACATATTGGGACGTCGAGAAGCTCTTCGTCGGCCAGGTGCAAGAG
GATGCCGTCGTTCTCAAGCTGCGCGACCAGAACAAGGACAATATCAACAAGGTGCTCCAGATCGTGCTCTCGCAC
AGCCGAGTCAGCGCAAAGAGCTCTCTCATGCTCGCCATCCTCGACGAGTACCGCCCCAACAGGCCCAACGTCGGC
AACATTGGCAAATACCTGCGCGACTCGCTTCGCAAGCTGACGGAGCTCTCGTCGCGGCCCACGTCCAAGGTGTCT
CTCAAGGCCCGCGAGATCATGATCCAGTGCTCGCTCCCGTCGCTGGAGGAGCGGACCGCCCAGCTGGAGCACATC
CTCCGCTCGTCAGTGGTCGAATCGCGCTACGGCGAGAGCGGCTGGGACCACCGCGAGCCCAACCTCGATGTCATC
AAAGAGGTGGTCGACTCCAAGTACACCGTCTTTGACGTGCTCCCGCTCTTCTTCGCCCACGAGGATCCGTGGGTG
GCGCTGGCGTCTCTGGAGGTCTACGTCCGTCGCTCGTATCGCGCCTACGTGCTGCAGCAGATCGAGTACCACAAC
GACGAGTCGGATCTGCCCCTTTTCGTCTCATGGGATTTCCAGCTTCGCAAGCTGGGCCAGTCCGAGTTTGGCCTG
CCGCTCATGTCGGCCGCGCCCTCGACGCCCGGCACGCCCGTGACTCCCGTCAACTCGAGGCCTTTCATGAACCGC
ATCTCGTCCATCAGCGACATGTCGTACCTCAACAGCAAGTGGGACGAAGAGCCGACACGCAAGGGCATCATCGCG
CCCTGCAGGTATCTCGACGACGCCGAGGACATGATCCAGAAGGCACTCGAGACCCTCGCAGTCCACAACAAGCAG
AAGAAGCTCAACAACGGCACCAATATCCTGGCCGAGCTCAACGGCAAGCGCAAGCCCTCGTCGGTCTTGAAGCAC
GATGTCAGGAAGGGTGACGAGCTGTCGGCCGTCATCAACATCGCCGTGCGCGACGCCGAGACGCGTGACGATGGG
GAGATCATGTCTCGCATCCTGCCCGTCGTCGAGCAGTTCAAGAGCGACATGCTCGCGCGCGGCGTCCGACGCCTC
ACCTTCATCTGCGGCCACAGCGACGGCGGGTATCCCGGCTACTACACGTTCCGCGGCCCCGAGTACAACGAGGAC
GACAGCATCCGTCACAGCGAGCCGGCCCTGGCTTTCCAGCTCGAGCTGGGACGCCTGGCAAAGTTCGGCATCAAG
CCCGTCTTCACGCAGAACAAGAACATCCACGTGTACGAGGCCGTCGGAAAGGCCGTCGATACTGATAAGCGCTAC
TTCACCCGCGCCGTGATCCGACCCGGACGTCTGCGCGACGAGATCCCAACGGCCGAGTACCTCATCTCCGAGGCG
GACCGCGTCATCAACGACATCTTTGACGCGCTCGAGATCATCGGCAACAACTCGTCGGATCTGAATCACATCTTT
ATGAACTTCACGCCCGTCTTCCAACTGGACCCGCAGCAGGTCGAGAAGAGCCTGCAGGGTTTCCTGGACCGCTTC
GGTCCCCGGGGCTGGCGGCTGCGCGTGTCGCAGGTCGAGATCCGCATCATCTGTACGGATCCGACGACCAGCACG
CCCTATCCCCTCCGCGTCGTCGTCACCAACACGTCGGGCTACATTGTCGACGTCGACATGTACGCCGAGCGAAAG
TCGGAGAAGGGCGAGTGGCTCTTCCACAGCATCGGCGGCACCAAGGAGAAGGGCCCGCTGCATCTGCTGTCCGTC
TCGACGCCCTACGCGACCAAGAACGCCCTCCAGCCGAAGCGCTACAAGGCGCATCTCATGGGCACGCAGTACGTC
TACGACTTCCCCGAGCTCTTCCGCCAGGCGATCCAGAACAGCTGGGCCAAGGCGGTACAGAATCAGCCCGCGCTG
GCGTCGCAGCGGCCCAAGGTCGGCGAGTGCATCACCTTTACCGAGCTGGTCCTCGACGAACAGGACAACATCGAC
GAGGTCAACCGCGAGCCCGGCACCAACACCTGCGGCATGGTCGGCTGGATCTTCCGGGCGCGCACCCCTGAGTAC
CCGGCCGGGCGGCGCTTCGTCGTCATCGCCAACGACATCACGTACAAAATCGGGTCTTTTGGGCCCAAGGAAGAC
AACTTCTTCCACAAGTGTACCGAGCTCGCCCGTAGGCTGGGCATCCCACGCATCTATCTGTCGGCCAACTCGGGC
GCGCGTCTGGGCCTGGCTGAGGAGCTGATCCCGCACTTCAAGGTGGCCTGGAACGACCCGGAGAAGCCCGAGGCC
GGGTTCCGCTACCTGTACCTCGACGACAAGACGAGGCAGGGCTTCAAGAAGGACGTCATCACCGAGGAGATTTCC
GAGGGAGGCGAGAAGCGCCACCGCATCGTCACCATTGTCGGTCAGGAGGACGGGCTCGGCGTCGAGTGCCTCAAA
GGGTCTGGTCTCATTGCCGGCGCGACTAGTCGGGCCTATGAGGAGATCTTTACGGTGACGCTGGTGACTTGCCGG
TCTGTTGGAATCGGCGCCTATCTCGTGCGCCTCGGTCAGCGAGCCGTGCAGATTGAAGGCCAGCCCATCATCCTG
ACGGGCGCCCCGGCCCTCAACAACCTGCTTGGTCGCGAAGTGTACACGTCGAATCTGCAGCTCGGCGGCACGCAG
ATCATGTACCGCAACGGTGTCTCCCACATGACGGCCAACGACGACTTTGCCGGCATCTCACGCATCGTCGAATGG
ATGTCGTTTGTGCCGGAGAAGCGCAATGGCCCTGTGCCCATCAGTCCGAGCGTCGATGACTGGAACCGCGACGTG
ACGTACTGCCCGCCGCAGAAGCAGCCGTACGACGTGCGGTGGATGATTGCCGGCAAAGAGGATGAGGACGGCGGC
TTCCTCAGCGGCCTCTTCGACAAGGACTCGTTCGTCGAGGCGCTCGGGGGCTGGGCGCGAACGGTTGTGGTGGGC
CGGGCGCGTCTGGGGGGCATCCCCATGGGCGTCATCGCCGTCGAGACGCGGTCGGTGGAGAACATTACGCCGGCC
GACCCGGCCAATCCGGACTCGATGGAGCAGGTGAGCAACGAGGCCGGCGGCGTGTGGTATCCCAACTCGGCCTTC
AAGACGGCGCAGGCCATCAACGACTTCAACAAGGGCGAGCAGCTGCCGTTGATGATTCTGGCCAACTGGCGCGGC
TTCTCGGGCGGGCAGCGCGACATGTACAACGAGGTACTCAAGTACGGGTCCTTCATCGTCGACGCGCTCGTCAAG
TTTGAGCAGCCCATCTTTGTGTACGTGCCGCCGTTTGGCGAGCTACGAGGCGGTTCGTGGGTTGTCGTCGACCCG
ACCATCAACCCGACCGTCATGGAGATGTACGCCGACGTCGAGGCGCGGGGTGGCGTGTTGGAGCCTGAAGGCATG
ATCGGCATCAAATACCGCAAGGAAAAGCAGCTGGAGACGATGGCGCGCCTGGACCCGATCTACGCCGGCTTCAAG
CGGCGACTGGAAGACAAGAGCCTGAGCGCCGAAGAGGCGGCCGAGGTCAAGTCGAAGATGACGATACGGGAAAAG
ATGCTGCTGCCGGTATACGCACAGGTGGCGGTGCAGTTTGCGGATCTGCACGACCGGGCCGGGCGGATGAAGGCC
AAGGGCGCGATCCGGGACTCGCTGTCTTGGATCAACGCCCGCCGCTTCTTCTACTGGCGGTTGCGACGACGGCTC
AACGAGGAGTATATCCTGAAGCGCATGGCGAACAAGGACGCCAACAACAACCAGGCCAAGGCGGCCGAGGCGCGG
GCGCGGAATATGCTGTTGCTGGAGAGCTGGTCGGGCATCACGGGCTGGGGACACAACGACCGCGAGGTGGCCGAA
TGGTACGAGAAGGAGCGAAAGTCGATTGGCGATAAGGTGGAGGCACTCAAGGCTGAGAAGGTGTCGGCCGAGGTG
TCGGAGGCGGTGCGCAGCCACAAGGACGCTGGATGGAAGGGGGTGCGCGAGGTGCTGAGGGTGATGCCGCCGGAG
GAGCGTGAGGCGATGCTCAAGTATCTCAAGGGGTGA
Gene >Ophun1|6439
ATGGTGTCAGCGACGCCTGTCGCCACAAACGGCACCAATGGTCGCACCGTTCCCGTCTCCAACGGAAAGGCGTCC
TACGCCGAGAAGCACGCCGTTGCTGACCACTTCATCGGAGGCAACGCTCTGGCCAATGCCCCGGCCGGCAAGGTC
AAGGACTTTGTCGCCCAAAACGATGGCCACACCGTCATCACAAACGTGGGAACCCGCTCGAACTGAATCGTGCCG
GCCTGCTTGCTCACTCATCCTCGGCAGGTCCTCATAGCAAATAACGGAATCGCCGCCGTCAAGGAGATCCGCTCC
GTCCGAAAATGGGCGTACGAGACGTTTGGCGACGAGCGTGCCATTCATTTCACCGTCATGGCCACCCCTGAGGAT
CTTCAGGCCAACGCAGACTACATTCGCATGGCCGATCACTACGTCGAGGTCCCGGGCGGCACCAACAACCACAAC
TACGCCAACGTGGAGCTGATAGTTGATATTGCCGAGCGGATGAATGTCCATGCCGTCTGGGCTGGCTGGTGATTT
TGTTCCCGTACCACTTCCGTATGCAGGGCGCTGACTGCCGCTTCAGGGGCCACGCCTCCGAGAACCCCAAGCTGC
CAGAGTCGCTGGCTGCCTCTCCCAATAAGATCGTCTTCATCGGACCCCCGGGATCCGCCATGAGGTCTCTGGGCG
ACAAAATATCGTCCACCATCGTTGCCCAGCACGCCCTCGTCCCCTGCATACCATGGTCCGGCACGGGTGTCAACG
CCGTCGACATCGACGCAAAGGGCATCGTCACCGTCCCAGATGACGTCTACGCCAAGGGCTGCGTCACTTCATGGC
AGGAAGGCCTGGAAAAGGCAAAGGAGATTGGCTTCCCCGTCATGATCAAAGCCTCAGAGGGTGGCGGCGGTAAGG
GCATCCGCAAAGCCACCAACGAGGACGAGTTCGAGGCCCTGTACAAGGCGGCAGCCAGCGAGATCCCGGGCTCGC
CCATCTTCATTATGAAGCTGGCCGGCAATGCCCGTCATCTCGAAGTCCAGTTGTTGGCTGACCAGTATGGCAACA
ACATCTCCCTGTTTGGCCGTGACTGCTCCGTCCAGCGGCGTCACCAGAAGATTATCGAGGAGGCGCCCGTCACCA
TCGCAAAGGCTGACACCTTCAAGGCCATGGAAGATGCCGCCGTCCGGCTGGGCAAGCTGGTTGGCTATGTCTCGG
CCGGCACCGTCGAATATCTATACTCGCACGCCGACGACAAATTCTACTTCCTCGAGCTCAACCCGCGTCTTCAGG
TCGAGCATCCGACGACGGAAATGGTCAGCGGCGTCAACCTGCCCGCAGCTCAGCTTCAGATCGCCATGGGCTTGC
CACTGCACCGTGTCCGCGATATCAGGCTGCTTTACGGCGTCGACCCCAAGGCCTCGAGCCTCATCGACTTCGAGT
TCAAGCAGCACGGCACCGCTCAGTCCCAGCGCCGCCCGACGCCCACCGGCCACACGACCGCCTGCCGCATTACCT
CGGAGGACCCGGGCGAGGGCTTCAAGCCGTCCAACGGCGTCATGCACGAGCTCAACTTCAGGAGCAGCTCCAATG
TCTGGGGCTACTTCTCCGTCGGCACCCAGGGTGGTATCCACAGCTTCTCCGACAGCCAGTTCGGCCATATATTCG
CCTACGGCGAGAATCGCCAGGCCTCGCGTAAGCACATGGTCGTGGCCCTCAAGGAACTCAGCATCCGCGGCGACT
TTCGAACCACTGTCGAGTACCTCATCAAGCTGCTCGAGACGGAAGACTTTGAGGAGAATACCATCTCGACCGGCT
GGCTCGACGAGCTCATCTCCAAGCGGCTGACCGCTGAGCGTCCGGACCCCATGCTCGCCGTCGTCTGCGGTGCCA
CCACAAAGGCCCACATCGCCAGCGAAGCATGCCTGGCCGAGTATCGAGCCGGCCTCGAAAAGGGTCAGGTGCCGT
CCAAGGAGATACTCAAGACAGTCTTCACCATCGACTTCATCTACGAGGGCTTCCGCTACAAGTTTACAGCCACCC
GCGCCAGCGCCGACAGCTACCACCTCTTCATCAACGGCTCCAAGTGCTCTGTAGGCGTCCGCGCCCTCAGCGACG
GTGGCCTGCTCATCCTCCTGGACGGCCACAGCCACAATGTCTACTGGAAGGAAGAGGTCGGCGCCACCCGTCTCT
CAGTTGACAGCAAGACGTGTCTCCTCGAGCAGGAAAACGATCCGACACAACTGCGGTCCCCCAGCCCCGGCAAGC
TCGTCAAGTACACGGTCGAGAACGGGGCTCACGTCAAGGCCGGCCAGACGTTCGCCGAGGTCGAGGTCATGAAGA
TGTACATGCCTCTCATTGCCCAGGAGGACGGCATTGTCCAGCTCATCAAGCAGCCTGGCGCCACCCTCGAGGCTG
GCGACATCCTCGGCATCCTCGCCCTCGACGATCCCAGCCGCGTGAAGCAGGCCCAGGCCTTCGTCGACAAACTCC
CGGCCTACGGGGAGCCCGTCGTCGTCGGCAACAAGCCCGCTCAGCGCTTCAGCGTCCTGCGCGACATCATCACCA
ACATCCACATGGGCTACGACAACTCGGTCATCATGGCGCCCGCTCTCAAGGAGCTCATCGAGGTGCTACGGAACC
CGGAGCTGCCATACAGCGAGTGGAACGCTTGCTTTTCTGCCCTGCACGCGCGCATGCCCCAGAAGCTCGACGCTC
AGCTGGTCCAGGTTGTCGAGCGCGCGAAGGCGCGTCATGCCGAGTTCCCGGCCAGGACCCTCATCAAGGCTCTGC
ACAAGTTCATGGAGGAGAGCGTGGCCGACGCCGACGTCGATCTGCTCAAGGTGACGCTCGCGCCCTTGCTGGAGA
TCTTGACGCAGTACGCCGACGGCCAAAAGGTCCGCGAACTCAACTTCATCGACAGGTTGCTGGAGACATATTGGG
ACGTCGAGAAGCTCTTCGTCGGCCAGGTGCAAGAGGATGCCGTCGTTCTCAAGCTGCGCGACCAGAACAAGGACA
ATATCAACAAGGTGCTCCAGATCGTGCTCTCGCACAGCCGAGTCAGCGCAAAGAGCTCTCTCATGCTCGCCATCC
TCGACGAGTACCGCCCCAACAGGCCCAACGTCGGCAACATTGGCAAATACCTGCGCGACTCGCTTCGCAAGCTGA
CGGAGCTCTCGTCGCGGCCCACGTCCAAGGTGTCTCTCAAGGCCCGCGAGATCATGATCCAGTGCTCGCTCCCGT
CGCTGGAGGAGCGGACCGCCCAGCTGGAGCACATCCTCCGCTCGTCAGTGGTCGAATCGCGCTACGGCGAGAGCG
GCTGGGACCACCGCGAGCCCAACCTCGATGTCATCAAAGAGGTGGTCGACTCCAAGTACACCGTCTTTGACGTGC
TCCCGCTCTTCTTCGCCCACGAGGATCCGTGGGTGGCGCTGGCGTCTCTGGAGGTCTACGTCCGTCGCTCGTATC
GCGCCTACGTGCTGCAGCAGATCGAGTACCACAACGACGAGTCGGATCTGCCCCTTTTCGTCTCATGGGATTTCC
AGCTTCGCAAGCTGGGCCAGTCCGAGTTTGGCCTGCCGCTCATGTCGGCCGCGCCCTCGACGCCCGGCACGCCCG
TGACTCCCGTCAACTCGAGGCCTTTCATGAACCGCATCTCGTCCATCAGCGACATGTCGTACCTCAACAGCAAGT
GGGACGAAGAGCCGACACGCAAGGGCATCATCGCGCCCTGCAGGTATCTCGACGACGCCGAGGACATGATCCAGA
AGGCACTCGAGACCCTCGCAGTCCACAACAAGCAGAAGAAGCTCAACAACGGCACCAATATCCTGGCCGAGCTCA
ACGGCAAGCGCAAGCCCTCGTCGGTCTTGAAGCACGATGTCAGGAAGGGTGACGAGCTGTCGGCCGTCATCAACA
TCGCCGTGCGCGACGCCGAGACGCGTGACGATGGGGAGATCATGTCTCGCATCCTGCCCGTCGTCGAGCAGTTCA
AGAGCGACATGCTCGCGCGCGGCGTCCGACGCCTCACCTTCATCTGCGGCCACAGCGACGGCGGGTATCCCGGCT
ACTACACGTTCCGCGGCCCCGAGTACAACGAGGACGACAGCATCCGTCACAGCGAGCCGGCCCTGGCTTTCCAGC
TCGAGCTGGGACGCCTGGCAAAGTTCGGCATCAAGCCCGTCTTCACGCAGAACAAGAACATCCACGTGTACGAGG
CCGTCGGAAAGGCCGTCGATACTGATAAGCGCTACTTCACCCGCGCCGTGATCCGACCCGGACGTCTGCGCGACG
AGATCCCAACGGCCGAGTACCTCATCTCCGAGGCGGACCGCGTCATCAACGACATCTTTGACGCGCTCGAGATCA
TCGGCAACAACTCGTCGGATCTGAATCACATCTTTATGAACTTCACGCCCGTCTTCCAACTGGACCCGCAGCAGG
TCGAGAAGAGCCTGCAGGGTTTCCTGGACCGCTTCGGTCCCCGGGGCTGGCGGCTGCGCGTGTCGCAGGTCGAGA
TCCGCATCATCTGTACGGATCCGACGACCAGCACGCCCTATCCCCTCCGCGTCGTCGTCACCAACACGTCGGGCT
ACATTGTCGACGTCGACATGTACGCCGAGCGAAAGTCGGAGAAGGGCGAGTGGCTCTTCCACAGCATCGGCGGCA
CCAAGGAGAAGGGCCCGCTGCATCTGCTGTCCGTCTCGACGCCCTACGCGACCAAGAACGCCCTCCAGCCGAAGC
GCTACAAGGCGCATCTCATGGGCACGCAGTACGTCTACGACTTCCCCGAGCTCTTCCGCCAGGCGATCCAGAACA
GCTGGGCCAAGGCGGTACAGAATCAGCCCGCGCTGGCGTCGCAGCGGCCCAAGGTCGGCGAGTGCATCACCTTTA
CCGAGCTGGTCCTCGACGAACAGGACAACATCGACGAGGTCAACCGCGAGCCCGGCACCAACACCTGCGGCATGG
TCGGCTGGATCTTCCGGGCGCGCACCCCTGAGTACCCGGCCGGGCGGCGCTTCGTCGTCATCGCCAACGACATCA
CGTACAAAATCGGGTCTTTTGGGCCCAAGGAAGACAACTTCTTCCACAAGTGTACCGAGCTCGCCCGTAGGCTGG
GCATCCCACGCATCTATCTGTCGGCCAACTCGGGCGCGCGTCTGGGCCTGGCTGAGGAGCTGATCCCGCACTTCA
AGGTGGCCTGGAACGACCCGGAGAAGCCCGAGGCCGGGTTCCGCTACCTGTACCTCGACGACAAGACGAGGCAGG
GCTTCAAGAAGGACGTCATCACCGAGGAGATTTCCGAGGGAGGCGAGAAGCGCCACCGCATCGTCACCATTGTCG
GTCAGGAGGACGGGCTCGGCGTCGAGTGCCTCAAAGGGTCTGGTCTCATTGCCGGCGCGACTAGTCGGGCCTATG
AGGAGATCTTTACGGTGACGCTGGTGACTTGCCGGTCTGTTGGTGAGTCTTACCCCTTTTCGTCTGAGCAGAACC
CCCTGGGGGTTTGACAAAGGCAAGAGAGATTCTGACGGGTGAAATTCTAGGAATCGGCGCCTATCTCGTGCGCCT
CGGTCAGCGAGCCGTGCAGATTGAAGGCCAGCCCATCATCCTGACGGGCGCCCCGGCCCTCAACAACCTGCTTGG
TCGCGAAGTGTACACGTCGAATCTGCAGCTCGGCGGCACGCAGATCATGTACCGCAACGGTGTCTCCCACATGAC
GGCCAACGACGACTTTGCCGGCATCTCACGCATCGTCGAATGGATGTCGTTTGTGCCGGAGAAGCGCAATGGCCC
TGTGCCCATCAGTCCGAGCGTCGATGACTGGAACCGCGACGTGACGTACTGCCCGCCGCAGAAGCAGCCGTACGA
CGTGCGGTGGATGATTGCCGGCAAAGAGGATGAGGACGGCGGCTTCCTCAGCGGCCTCTTCGACAAGGACTCGTT
CGTCGAGGCGCTCGGGGGCTGGGCGCGAACGGTTGTGGTGGGCCGGGCGCGTCTGGGGGGCATCCCCATGGGCGT
CATCGCCGTCGAGACGCGGTCGGTGGAGAACATTACGCCGGCCGACCCGGCCAATCCGGACTCGATGGAGCAGGT
GAGCAACGAGGCCGGCGGCGTGTGGTATCCCAACTCGGCCTTCAAGACGGCGCAGGCCATCAACGACTTCAACAA
GGGCGAGCAGCTGCCGTTGATGATTCTGGCCAACTGGCGCGGCTTCTCGGGCGGGCAGCGCGACATGTACAACGA
GGTACTCAAGTACGGGTCCTTCATCGTCGACGCGCTCGTCAAGTTTGAGCAGCCCATCTTTGTGTACGTGCCGCC
GTTTGGCGAGCTACGAGGCGGTTCGTGGGTTGTCGTCGACCCGACCATCAACCCGACCGTCATGGAGATGTACGC
CGACGTCGAGGCGCGGGGTGGCGTGTTGGAGCCTGAAGGCATGATCGGCATCAAATACCGCAAGGAAAAGCAGCT
GGAGACGATGGCGCGCCTGGACCCGATCTACGCCGGCTTCAAGCGGCGACTGGAAGACAAGAGCCTGAGCGCCGA
AGAGGCGGCCGAGGTCAAGTCGAAGATGACGATACGGGAAAAGATGCTGCTGCCGGTATACGCACAGGTGGCGGT
GCAGTTTGCGGATCTGCACGACCGGGCCGGGCGGATGAAGGCCAAGGGCGCGATCCGGGACTCGCTGTCTTGGAT
CAACGCCCGCCGCTTCTTCTACTGGCGGTTGCGACGACGGCTCAACGAGGAGTATATCCTGAAGCGCATGGCGAA
CAAGGACGCCAACAACAACCAGGCCAAGGCGGCCGAGGCGCGGGCGCGGAATATGCTGTTGCTGGAGAGCTGGTC
GGGCATCACGGGCTGGGGACACAACGACCGCGAGGTGGCCGAATGGTACGAGAAGGAGCGAAAGTCGATTGGCGA
TAAGGTGGAGGCACTCAAGGCTGAGAAGGTGTCGGCCGAGGTGTCGGAGGCGGTGCGCAGCCACAAGGACGCTGG
ATGGAAGGGGGTGCGCGAGGTGCTGAGGGTGATGCCGCCGGAGGAGCGTGAGGCGATGCTCAAGTATCTCAAGGG
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail