Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6438
Gene name
LocationContig_70:22714..24507
Strand+
Gene length (bp)1793
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04880 NUDE_C NUDE protein, C-terminal conserved region 8.8E-43 131 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I877|NDE1_GIBZE Nuclear distribution protein nudE homolog 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NDE1 PE=3 SV=1 2 578 0.0E+00
sp|O13335|NDE1_NEUCR Nuclear distribution protein nudE homolog 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-11 PE=3 SV=1 2 578 6.0E-140
sp|O74689|NDE1_EMENI Nuclear distribution protein nudE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudE PE=1 SV=1 2 428 1.0E-92
sp|Q4X1V0|NDE1_ASPFU Nuclear distribution protein nudE homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nde1 PE=3 SV=1 9 232 1.0E-74
sp|Q4P0N6|NDE1_USTMA Nuclear distribution protein nudE homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NDE1 PE=3 SV=2 30 212 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I877|NDE1_GIBZE Nuclear distribution protein nudE homolog 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NDE1 PE=3 SV=1 2 578 0.0E+00
sp|O13335|NDE1_NEUCR Nuclear distribution protein nudE homolog 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-11 PE=3 SV=1 2 578 6.0E-140
sp|O74689|NDE1_EMENI Nuclear distribution protein nudE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudE PE=1 SV=1 2 428 1.0E-92
sp|Q4X1V0|NDE1_ASPFU Nuclear distribution protein nudE homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nde1 PE=3 SV=1 9 232 1.0E-74
sp|Q4P0N6|NDE1_USTMA Nuclear distribution protein nudE homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NDE1 PE=3 SV=2 30 212 4.0E-26
sp|P0CP39|NDE1_CRYNB Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NDE1 PE=3 SV=1 14 190 5.0E-26
sp|P0CP38|NDE1_CRYNJ Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NDE1 PE=3 SV=1 14 190 6.0E-26
sp|Q5ZKH4|NDEL1_CHICK Nuclear distribution protein nudE-like 1 OS=Gallus gallus GN=NDEL1 PE=2 SV=1 4 180 2.0E-23
sp|Q6C3S1|NDE1_YARLI Nuclear distribution protein nudE homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDE1 PE=3 SV=1 5 188 7.0E-23
sp|Q9GZM8|NDEL1_HUMAN Nuclear distribution protein nudE-like 1 OS=Homo sapiens GN=NDEL1 PE=1 SV=1 4 313 8.0E-23
sp|Q78PB6|NDEL1_RAT Nuclear distribution protein nudE-like 1 OS=Rattus norvegicus GN=Ndel1 PE=1 SV=1 4 180 9.0E-23
sp|Q9ERR1|NDEL1_MOUSE Nuclear distribution protein nudE-like 1 OS=Mus musculus GN=Ndel1 PE=1 SV=2 4 180 9.0E-23
sp|Q5R8T7|NDEL1_PONAB Nuclear distribution protein nudE-like 1 OS=Pongo abelii GN=NDEL1 PE=2 SV=1 4 313 1.0E-22
sp|O46480|NDEL1_RABIT Nuclear distribution protein nudE-like 1 OS=Oryctolagus cuniculus GN=NDEL1 PE=1 SV=3 4 180 2.0E-22
sp|Q4R4S6|NDEL1_MACFA Nuclear distribution protein nudE-like 1 OS=Macaca fascicularis GN=NDEL1 PE=2 SV=2 4 180 3.0E-22
sp|Q7SXI6|NDL1A_DANRE Nuclear distribution protein nudE-like 1-A OS=Danio rerio GN=ndel1a PE=2 SV=1 9 180 1.0E-20
sp|Q9NXR1|NDE1_HUMAN Nuclear distribution protein nudE homolog 1 OS=Homo sapiens GN=NDE1 PE=1 SV=2 6 189 2.0E-20
sp|Q28CJ6|NDEL1_XENTR Nuclear distribution protein nudE-like 1 OS=Xenopus tropicalis GN=ndel1 PE=2 SV=1 7 180 3.0E-20
sp|Q6DK98|NDL1A_XENLA Nuclear distribution protein nudE-like 1-A OS=Xenopus laevis GN=ndel1-a PE=2 SV=1 16 180 4.0E-20
sp|Q803Q2|NDL1B_DANRE Nuclear distribution protein nudE-like 1-B OS=Danio rerio GN=ndel1b PE=2 SV=1 4 212 8.0E-20
sp|Q9ES39|NDE1_RAT Nuclear distribution protein nudE homolog 1 OS=Rattus norvegicus GN=Nde1 PE=1 SV=1 22 189 9.0E-20
sp|Q9CZA6|NDE1_MOUSE Nuclear distribution protein nudE homolog 1 OS=Mus musculus GN=Nde1 PE=1 SV=1 22 189 3.0E-19
sp|Q66JL0|NDE1_XENTR Nuclear distribution protein nudE homolog 1 OS=Xenopus tropicalis GN=nde1 PE=2 SV=1 16 185 3.0E-19
sp|Q66IZ7|NDL1B_XENLA Nuclear distribution protein nudE-like 1-B OS=Xenopus laevis GN=ndel1-b PE=2 SV=1 7 180 4.0E-19
sp|Q6NRJ5|NDE1B_XENLA Nuclear distribution protein nudE homolog 1-B OS=Xenopus laevis GN=nde1-b PE=2 SV=2 16 185 8.0E-19
sp|Q66J96|NDE1A_XENLA Nuclear distribution protein nudE homolog 1-A OS=Xenopus laevis GN=nde1-a PE=1 SV=1 16 189 1.0E-18
sp|Q5ZMC9|NDE1_CHICK Nuclear distribution protein nudE homolog 1 OS=Gallus gallus GN=NDE1 PE=2 SV=1 22 189 4.0E-18
sp|Q9VT70|NDE1_DROME Nuclear distribution protein nudE homolog OS=Drosophila melanogaster GN=nudE PE=2 SV=2 7 180 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5294
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|613
Ophiocordyceps australis map64 (Brazil) OphauB2|244
Ophiocordyceps camponoti-rufipedis Ophun1|6438 (this protein)
Ophiocordyceps kimflemingae Ophio5|7966
Ophiocordyceps subramaniannii Hirsu2|4747

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6438
MAEPPSSPPSEATSAEDALSWYKSQYELLESELAEFRESSRELEKELEKDIERAEKQERMFQEKAEALGFEVEEW
KRKHKEAKTEAGAAQAALEKEITTLRDSNRSLQLRLRDIEVANDDFERQARNTSSSLEDMESKYNQAIERGVMME
EEIKAGEQEREQLRIDSQRLREELADLKIEAELMQDKIKKHEARHLSAISTDLSALGSPTFDKHPEESPESSASS
PLVTTPTETNKALSRASDVTDPPSPPMSDASAPVQRVAEAAARTKTPCKAVDGPSRKSRLPSLDGNATPKMRPRP
SLGTATAPARAPGGRVSGVGVNIRTPSARQPKARVAAAHKIPASNSLSHIRSLTAQMQRLEARVQSARSKLPAPT
TSLSPRASPRGSSLGHHVPSTVTIRSRKRAVASSASSMAGDEEATPTNARATRSHVPRLSTSGVGRLSFGPVPNR
GPEPDMSRPSSRASHSSQARPASRTDMVPPPRPISQTSVTRTPLGRPRSSMSGSLHSRSGSVGRAEEDEFRTPSR
RGTYSKVETESGIPVPGSGIPTPSSRRQSGGRHTGRESAAGRHRKLSDLGETY*
Coding >Ophun1|6438
ATGGCTGAGCCGCCCTCGTCGCCTCCGAGCGAGGCCACCAGCGCCGAAGATGCTCTCTCCTGGTACAAGTCGCAG
TACGAGCTGCTTGAGTCCGAACTTGCCGAATTTCGTGAATCGAGCCGCGAACTGGAGAAGGAGTTGGAAAAAGAC
ATTGAGCGCGCCGAAAAGCAGGAGAGAATGTTCCAGGAAAAGGCCGAGGCGCTGGGCTTCGAGGTGGAAGAGTGG
AAGAGGAAACATAAGGAGGCCAAAACCGAAGCCGGCGCGGCCCAGGCGGCTCTTGAAAAGGAGATCACAACACTC
AGAGACTCGAACAGGTCGCTACAGCTGCGGCTGAGAGATATCGAAGTGGCAAACGACGACTTTGAGCGCCAGGCA
CGCAATACATCATCCTCATTGGAAGACATGGAGTCCAAATACAACCAGGCCATCGAGCGCGGCGTCATGATGGAG
GAGGAGATCAAGGCGGGCGAGCAAGAGCGAGAGCAGCTGCGCATCGACTCGCAGCGACTGCGCGAAGAGTTGGCC
GACCTCAAGATCGAGGCCGAGCTGATGCAAGACAAGATCAAGAAACACGAGGCGAGGCACCTGTCGGCCATCTCG
ACCGACCTCTCAGCCCTGGGCTCACCCACTTTTGACAAGCATCCCGAGGAGTCGCCGGAATCGTCTGCCAGTTCG
CCGCTCGTCACGACGCCTACGGAGACGAACAAGGCCTTGTCCCGCGCCTCCGACGTCACCGACCCGCCGTCTCCG
CCCATGTCGGATGCTTCGGCTCCCGTCCAGAGGGTAGCAGAGGCAGCAGCAAGGACGAAGACGCCGTGCAAGGCC
GTGGACGGGCCATCTCGCAAGTCCCGTCTGCCGTCGCTCGACGGTAACGCCACGCCCAAGATGCGGCCCCGCCCG
TCCTTGGGCACGGCCACGGCTCCCGCGCGGGCCCCCGGAGGTAGGGTCTCTGGCGTCGGCGTCAATATCCGGACG
CCGTCGGCCCGACAGCCTAAAGCGCGCGTTGCCGCTGCGCACAAGATTCCCGCTTCCAACTCGCTGTCGCACATC
CGGTCGCTCACGGCGCAAATGCAGCGGCTCGAAGCCCGAGTGCAATCGGCCCGATCCAAGCTACCGGCGCCGACG
ACCTCGTTGTCCCCGAGAGCATCACCGAGAGGGTCCAGTCTCGGACACCACGTGCCATCGACTGTGACGATCCGC
AGCCGGAAGCGAGCCGTAGCGTCATCGGCCTCGTCCATGGCGGGCGACGAGGAGGCGACGCCGACCAACGCGCGC
GCCACCAGAAGTCACGTCCCGCGACTCAGCACGTCCGGTGTAGGCCGACTCTCGTTTGGGCCGGTGCCGAACCGA
GGCCCCGAGCCGGACATGAGCCGGCCGAGCTCTCGGGCCAGCCACTCGTCGCAAGCGAGGCCGGCGTCGAGGACG
GACATGGTGCCACCGCCGCGGCCCATTTCGCAGACTTCGGTGACACGGACGCCGCTGGGCAGGCCGCGGTCCTCG
ATGAGCGGGTCCCTCCACAGCCGCTCGGGGAGCGTCGGGCGCGCCGAAGAGGACGAGTTCCGGACACCAAGTCGG
CGAGGGACGTACTCAAAGGTCGAGACGGAGTCGGGCATCCCGGTGCCGGGGAGTGGCATACCGACGCCAAGCTCC
AGAAGGCAGAGCGGCGGGAGGCATACGGGCCGGGAGTCTGCAGCGGGACGGCACAGGAAGCTTAGCGACCTGGGC
GAGACATACTGA
Transcript >Ophun1|6438
ATGGCTGAGCCGCCCTCGTCGCCTCCGAGCGAGGCCACCAGCGCCGAAGATGCTCTCTCCTGGTACAAGTCGCAG
TACGAGCTGCTTGAGTCCGAACTTGCCGAATTTCGTGAATCGAGCCGCGAACTGGAGAAGGAGTTGGAAAAAGAC
ATTGAGCGCGCCGAAAAGCAGGAGAGAATGTTCCAGGAAAAGGCCGAGGCGCTGGGCTTCGAGGTGGAAGAGTGG
AAGAGGAAACATAAGGAGGCCAAAACCGAAGCCGGCGCGGCCCAGGCGGCTCTTGAAAAGGAGATCACAACACTC
AGAGACTCGAACAGGTCGCTACAGCTGCGGCTGAGAGATATCGAAGTGGCAAACGACGACTTTGAGCGCCAGGCA
CGCAATACATCATCCTCATTGGAAGACATGGAGTCCAAATACAACCAGGCCATCGAGCGCGGCGTCATGATGGAG
GAGGAGATCAAGGCGGGCGAGCAAGAGCGAGAGCAGCTGCGCATCGACTCGCAGCGACTGCGCGAAGAGTTGGCC
GACCTCAAGATCGAGGCCGAGCTGATGCAAGACAAGATCAAGAAACACGAGGCGAGGCACCTGTCGGCCATCTCG
ACCGACCTCTCAGCCCTGGGCTCACCCACTTTTGACAAGCATCCCGAGGAGTCGCCGGAATCGTCTGCCAGTTCG
CCGCTCGTCACGACGCCTACGGAGACGAACAAGGCCTTGTCCCGCGCCTCCGACGTCACCGACCCGCCGTCTCCG
CCCATGTCGGATGCTTCGGCTCCCGTCCAGAGGGTAGCAGAGGCAGCAGCAAGGACGAAGACGCCGTGCAAGGCC
GTGGACGGGCCATCTCGCAAGTCCCGTCTGCCGTCGCTCGACGGTAACGCCACGCCCAAGATGCGGCCCCGCCCG
TCCTTGGGCACGGCCACGGCTCCCGCGCGGGCCCCCGGAGGTAGGGTCTCTGGCGTCGGCGTCAATATCCGGACG
CCGTCGGCCCGACAGCCTAAAGCGCGCGTTGCCGCTGCGCACAAGATTCCCGCTTCCAACTCGCTGTCGCACATC
CGGTCGCTCACGGCGCAAATGCAGCGGCTCGAAGCCCGAGTGCAATCGGCCCGATCCAAGCTACCGGCGCCGACG
ACCTCGTTGTCCCCGAGAGCATCACCGAGAGGGTCCAGTCTCGGACACCACGTGCCATCGACTGTGACGATCCGC
AGCCGGAAGCGAGCCGTAGCGTCATCGGCCTCGTCCATGGCGGGCGACGAGGAGGCGACGCCGACCAACGCGCGC
GCCACCAGAAGTCACGTCCCGCGACTCAGCACGTCCGGTGTAGGCCGACTCTCGTTTGGGCCGGTGCCGAACCGA
GGCCCCGAGCCGGACATGAGCCGGCCGAGCTCTCGGGCCAGCCACTCGTCGCAAGCGAGGCCGGCGTCGAGGACG
GACATGGTGCCACCGCCGCGGCCCATTTCGCAGACTTCGGTGACACGGACGCCGCTGGGCAGGCCGCGGTCCTCG
ATGAGCGGGTCCCTCCACAGCCGCTCGGGGAGCGTCGGGCGCGCCGAAGAGGACGAGTTCCGGACACCAAGTCGG
CGAGGGACGTACTCAAAGGTCGAGACGGAGTCGGGCATCCCGGTGCCGGGGAGTGGCATACCGACGCCAAGCTCC
AGAAGGCAGAGCGGCGGGAGGCATACGGGCCGGGAGTCTGCAGCGGGACGGCACAGGAAGCTTAGCGACCTGGGC
GAGACATACTGA
Gene >Ophun1|6438
ATGGCTGAGCCGCCCTCGTCGCCTCCGAGCGAGGCCACCAGCGCCGAAGATGCTCTCTCCTGGTACAAGTCGCAG
TACGAGCTGCTTGAGTCCGAACTTGCCGAATTTCGTGAATCGAGCCGCGAACTGGAGAAGGAGTTGGAAAAAGAC
ATTGAGCGCGCCGAAAAGCAGGAGAGAATGTTCCAGGAAAAGGCCGAGGCGCTGGGCTTCGAGGTGGAAGAGTGG
AAGGTATCCCTTCTCGTCACCTCCATCACTCTTGGCCGCTGACTGAACGTCTCGTGCAGAGGAAACATAAGGAGG
CCAAAACCGAAGCCGGCGCGGCCCAGGCGGCTCTTGAAAAGGAGATCACAACACTCAGAGACTCGAACAGGTCGC
TACAGCTGCGGCTGAGAGATATCGAAGTGGCAAACGACGACTTTGAGCGCCAGGCACGCAATACATCATCCTCAT
TGGAAGACATGGAGTCCAAATACAACCAGGCCATCGAGCGCGGCGTCATGATGGAGGAGGAGATCAAGGCGGGCG
AGCAAGAGCGAGAGCAGCTGCGCATCGACTCGCAGCGACTGCGCGAAGAGTTGGCCGACCTCAAGATCGAGGCCG
AGCTGATGCAAGACAAGATCAAGAAACACGAGGCGAGGCACCTGTCGGCCATCTCGACCGACCTCTCAGCCCTGG
GCTCACCCACTTTTGACAAGCATCCCGAGGAGTCGCCGGAATCGTCTGCCAGTTCGCCGCTCGTCACGACGCCTA
CGGAGACGAACAAGGCCTTGTCCCGCGCCTCCGACGTCACCGACCCGCCGTCTCCGCCCATGTCGGATGCTTCGG
CTCCCGTCCAGAGGGTAGCAGAGGCAGCAGCAAGGACGAAGACGCCGTGCAAGGCCGTGGACGGGCCATCTCGCA
AGTCCCGTCTGCCGTCGCTCGACGGTAACGCCACGCCCAAGATGCGGCCCCGCCCGTCCTTGGGCACGGCCACGG
CTCCCGCGCGGGCCCCCGGAGGTAGGGTCTCTGGCGTCGGCGTCAATATCCGGACGCCGTCGGCCCGACAGCCTA
AAGCGCGCGTTGCCGCTGCGCACAAGATTCCCGCTTCCAACTCGCTGTCGCACATCCGGTCGCTCACGGCGCAAA
TGCAGCGGCTCGAAGCCCGAGTGCAATCGGCCCGATCCAAGCTACCGGCGCCGACGACCTCGTTGTCCCCGAGAG
CATCACCGAGAGGGTCCAGTCTCGGACACCACGTGCCATCGACTGTGACGATCCGCAGCCGGAAGCGAGCCGTAG
CGTCATCGGCCTCGTCCATGGCGGGCGACGAGGAGGCGACGCCGACCAACGCGCGCGCCACCAGAAGTCACGTCC
CGCGACTCAGCACGTCCGGTGTAGGCCGACTCTCGTTTGGGCCGGTGCCGAACCGAGGCCCCGAGCCGGACATGA
GCCGGCCGAGCTCTCGGGCCAGCCACTCGTCGCAAGCGAGGCCGGCGTCGAGGACGGACATGGTGCCACCGCCGC
GGCCCATTTCGCAGACTTCGGTGACACGGACGCCGCTGGGCAGGCCGCGGTCCTCGATGAGCGGGTCCCTCCACA
GCCGCTCGGGGAGCGTCGGGCGCGCCGAAGAGGACGAGTTCCGGACACCAAGTCGGCGAGGGACGTACTCAAAGG
TCGAGACGGAGTCGGGCATCCCGGTGCCGGGGAGTGGCATACCGACGCCAAGCTCCAGAAGGCAGAGCGGCGGGA
GGCATACGGGCCGGGAGTCTGCAGCGGGACGGCACAGGAAGCTTAGCGACCTGGGCGAGACATACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail