Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6426
Gene name
LocationContig_7:65492..66939
Strand-
Gene length (bp)1447
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16546 SGTA_dimer Homodimerisation domain of SGTA 1.9E-24 15 78
PF00515 TPR_1 Tetratricopeptide repeat 3.4E-08 117 150
PF07719 TPR_2 Tetratricopeptide repeat 9.7E-07 117 150
PF13414 TPR_11 TPR repeat 2.1E-08 124 161
PF13181 TPR_8 Tetratricopeptide repeat 8.0E-03 122 150
PF13181 TPR_8 Tetratricopeptide repeat 1.8E-01 186 213
PF13432 TPR_16 Tetratricopeptide repeat 1.6E-04 123 170
PF13432 TPR_16 Tetratricopeptide repeat 3.0E-03 163 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 13 336 2.0E-56
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 13 333 5.0E-54
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 14 330 2.0E-49
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 15 292 6.0E-40
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 15 329 8.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 13 336 2.0E-56
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 13 333 5.0E-54
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 14 330 2.0E-49
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 15 292 6.0E-40
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 15 329 8.0E-38
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 14 292 8.0E-38
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 15 329 1.0E-36
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 13 319 3.0E-35
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 13 319 2.0E-34
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 13 319 3.0E-34
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 13 304 5.0E-32
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 117 296 3.0E-21
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 116 296 8.0E-18
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 117 334 9.0E-17
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 117 294 1.0E-16
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 117 296 5.0E-16
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 121 296 5.0E-16
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 111 225 5.0E-16
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 117 208 7.0E-16
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 98 294 7.0E-16
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 98 225 2.0E-15
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 115 294 2.0E-15
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 105 218 2.0E-15
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 74 215 3.0E-15
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 121 217 3.0E-15
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 117 296 7.0E-15
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 111 215 9.0E-15
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 121 294 2.0E-14
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 120 334 2.0E-14
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 120 334 2.0E-14
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 91 224 3.0E-14
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 120 334 3.0E-14
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 120 296 4.0E-14
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 117 299 5.0E-14
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 117 208 5.0E-14
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 120 296 6.0E-14
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 120 296 7.0E-14
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 117 213 1.0E-13
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 91 224 1.0E-13
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 121 218 1.0E-13
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 91 208 2.0E-13
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 117 296 7.0E-13
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 115 212 2.0E-12
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 121 294 6.0E-12
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 115 296 7.0E-12
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 89 208 2.0E-11
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 121 294 2.0E-11
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 121 296 2.0E-11
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 109 204 3.0E-11
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 121 294 5.0E-11
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 92 213 5.0E-11
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 121 294 6.0E-11
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 121 294 6.0E-11
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 92 213 9.0E-11
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 121 294 1.0E-10
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 92 213 1.0E-10
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 114 228 1.0E-10
sp|Q9H892|TTC12_HUMAN Tetratricopeptide repeat protein 12 OS=Homo sapiens GN=TTC12 PE=1 SV=2 83 264 1.0E-10
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 89 208 2.0E-10
sp|Q80ZK9|WDTC1_MOUSE WD and tetratricopeptide repeats protein 1 OS=Mus musculus GN=Wdtc1 PE=1 SV=1 118 207 3.0E-10
sp|Q80XJ3|TTC28_MOUSE Tetratricopeptide repeat protein 28 OS=Mus musculus GN=Ttc28 PE=1 SV=3 105 212 5.0E-10
sp|Q95LY5|TTC12_MACFA Tetratricopeptide repeat protein 12 (Fragment) OS=Macaca fascicularis GN=TTC12 PE=2 SV=1 83 213 6.0E-10
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 117 204 7.0E-10
sp|Q8N5D0|WDTC1_HUMAN WD and tetratricopeptide repeats protein 1 OS=Homo sapiens GN=WDTC1 PE=1 SV=2 118 207 8.0E-10
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 118 245 1.0E-09
sp|Q96AY4|TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens GN=TTC28 PE=1 SV=4 105 212 2.0E-09
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 111 208 3.0E-09
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 108 208 1.0E-08
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 108 208 1.0E-08
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 108 199 1.0E-08
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 28 312 2.0E-08
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 111 205 2.0E-08
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 116 204 3.0E-08
sp|Q86DS1|F10A2_DROME Hsc70-interacting protein 2 OS=Drosophila melanogaster GN=HIP-R PE=1 SV=2 107 323 3.0E-08
sp|C4NYP8|F10A1_DROME Hsc70-interacting protein 1 OS=Drosophila melanogaster GN=HIP PE=1 SV=2 107 323 3.0E-08
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 110 263 4.0E-08
sp|Q9SUR9|SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana GN=SGT1A PE=1 SV=1 139 211 7.0E-08
sp|Q8BW49|TTC12_MOUSE Tetratricopeptide repeat protein 12 OS=Mus musculus GN=Ttc12 PE=1 SV=1 117 210 7.0E-08
sp|Q9CZW5|TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus GN=Tomm70a PE=1 SV=2 117 273 2.0E-07
sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 117 273 2.0E-07
sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 117 273 2.0E-07
sp|Q9D6K7|TTC33_MOUSE Tetratricopeptide repeat protein 33 OS=Mus musculus GN=Ttc33 PE=1 SV=1 102 264 3.0E-07
sp|F4IXE4|TTL2_ARATH TPR repeat-containing thioredoxin TTL2 OS=Arabidopsis thaliana GN=TTL2 PE=2 SV=2 118 199 3.0E-07
sp|Q9SUT5|SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana GN=SGT1B PE=1 SV=1 117 211 4.0E-07
sp|Q9MAH1|TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana GN=TTL1 PE=1 SV=1 116 204 4.0E-07
sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 120 206 4.0E-07
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 114 214 7.0E-07
sp|P25407|STI1L_PLAFA STI1-like protein (Fragment) OS=Plasmodium falciparum PE=4 SV=1 114 220 7.0E-07
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 114 214 8.0E-07
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 114 214 8.0E-07
sp|O16259|STIP1_CAEEL Stress-induced-phosphoprotein 1 OS=Caenorhabditis elegans GN=sti-1 PE=1 SV=1 117 296 1.0E-06
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 114 214 3.0E-06
sp|P38825|TOM71_YEAST Protein TOM71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM71 PE=1 SV=1 109 205 3.0E-06
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 106 236 4.0E-06
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 114 220 5.0E-06
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 117 228 5.0E-06
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 109 202 5.0E-06
sp|F1RBN2|SPAG1_DANRE Sperm-associated antigen 1A OS=Danio rerio GN=spag1a PE=2 SV=1 107 200 5.0E-06
sp|Q9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP OS=Homo sapiens GN=STUB1 PE=1 SV=2 105 212 6.0E-06
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 114 214 7.0E-06
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 118 211 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6426
MINEKNVAASQQSSRQRLALAICHFLNTSLSDGTLAADEKDSIDVAVSCIAECFKVDAADEQAVKSAVGSQSLLQ
IYSVYDKLKGSEGSSASASASASANTSKPTPEKPSESQKKEAEALKSKGNAAMAQKQYQQAITLYSQALDLDPAN
AVFLSNRAAAHSAAKDHSSAKQDAEAAVAIDPSYTKAWSRLGLARFALGDAKGAMEAYAKGIEHEGNGGSEAMRK
GFETAKRRVDESDGATDAGDNLSSSRAAPQSSPSGMPDFGSIMSNPMFASMAQNLMSNPDLMSSLMSNPRLREMA
DSFGAGGAGGGGMPDIGSLMSDPNIADMARNLMGGANPGQNRNNNNNNSQP*
Coding >Ophun1|6426
ATGATCAATGAGAAGAACGTAGCGGCATCGCAGCAAAGCTCGAGGCAGCGCCTCGCCCTCGCCATCTGTCACTTT
CTCAACACGTCGCTCTCGGACGGAACCCTCGCCGCCGATGAAAAGGACTCCATCGACGTGGCCGTCAGCTGCATC
GCCGAATGCTTCAAGGTCGACGCCGCAGATGAGCAGGCGGTAAAGTCAGCCGTGGGATCGCAGTCGCTGCTGCAA
ATCTACTCCGTCTACGACAAGCTCAAAGGCAGCGAAGGCAGCAGCGCAAGTGCCAGCGCCAGCGCCAGCGCCAAC
ACCAGCAAGCCAACCCCCGAGAAGCCCTCGGAGTCGCAGAAGAAGGAGGCCGAAGCCCTCAAGTCAAAGGGCAAC
GCCGCCATGGCCCAGAAACAATACCAACAAGCCATAACCCTCTACAGCCAAGCCCTCGACCTCGACCCCGCAAAC
GCAGTCTTCCTCTCCAACCGCGCGGCCGCCCACTCAGCCGCAAAGGATCACTCTAGCGCAAAGCAGGACGCCGAG
GCCGCCGTCGCCATCGACCCTTCCTACACAAAGGCCTGGTCTCGTCTCGGTCTCGCCCGCTTCGCCCTCGGTGAC
GCAAAGGGCGCCATGGAAGCCTACGCAAAGGGCATCGAGCATGAGGGCAACGGCGGATCGGAAGCGATGCGCAAG
GGCTTCGAGACGGCCAAGCGTCGCGTCGATGAATCGGACGGCGCCACAGATGCCGGCGACAATCTCTCTTCTTCC
CGCGCCGCGCCCCAGTCTTCTCCTTCGGGCATGCCCGACTTTGGCTCCATCATGAGCAACCCGATGTTCGCCAGC
ATGGCCCAGAACCTCATGAGCAACCCGGACCTCATGTCAAGCCTCATGAGCAACCCGCGCCTGCGCGAGATGGCC
GACTCTTTTGGCGCCGGAGGTGCCGGAGGTGGTGGGATGCCCGACATTGGCAGCCTCATGTCAGACCCTAACATC
GCCGACATGGCACGCAATCTCATGGGCGGCGCAAATCCCGGCCAGAACAGGAACAACAACAATAACAACTCGCAG
CCTTAA
Transcript >Ophun1|6426
ATGATCAATGAGAAGAACGTAGCGGCATCGCAGCAAAGCTCGAGGCAGCGCCTCGCCCTCGCCATCTGTCACTTT
CTCAACACGTCGCTCTCGGACGGAACCCTCGCCGCCGATGAAAAGGACTCCATCGACGTGGCCGTCAGCTGCATC
GCCGAATGCTTCAAGGTCGACGCCGCAGATGAGCAGGCGGTAAAGTCAGCCGTGGGATCGCAGTCGCTGCTGCAA
ATCTACTCCGTCTACGACAAGCTCAAAGGCAGCGAAGGCAGCAGCGCAAGTGCCAGCGCCAGCGCCAGCGCCAAC
ACCAGCAAGCCAACCCCCGAGAAGCCCTCGGAGTCGCAGAAGAAGGAGGCCGAAGCCCTCAAGTCAAAGGGCAAC
GCCGCCATGGCCCAGAAACAATACCAACAAGCCATAACCCTCTACAGCCAAGCCCTCGACCTCGACCCCGCAAAC
GCAGTCTTCCTCTCCAACCGCGCGGCCGCCCACTCAGCCGCAAAGGATCACTCTAGCGCAAAGCAGGACGCCGAG
GCCGCCGTCGCCATCGACCCTTCCTACACAAAGGCCTGGTCTCGTCTCGGTCTCGCCCGCTTCGCCCTCGGTGAC
GCAAAGGGCGCCATGGAAGCCTACGCAAAGGGCATCGAGCATGAGGGCAACGGCGGATCGGAAGCGATGCGCAAG
GGCTTCGAGACGGCCAAGCGTCGCGTCGATGAATCGGACGGCGCCACAGATGCCGGCGACAATCTCTCTTCTTCC
CGCGCCGCGCCCCAGTCTTCTCCTTCGGGCATGCCCGACTTTGGCTCCATCATGAGCAACCCGATGTTCGCCAGC
ATGGCCCAGAACCTCATGAGCAACCCGGACCTCATGTCAAGCCTCATGAGCAACCCGCGCCTGCGCGAGATGGCC
GACTCTTTTGGCGCCGGAGGTGCCGGAGGTGGTGGGATGCCCGACATTGGCAGCCTCATGTCAGACCCTAACATC
GCCGACATGGCACGCAATCTCATGGGCGGCGCAAATCCCGGCCAGAACAGGAACAACAACAATAACAACTCGCAG
CCTTAA
Gene >Ophun1|6426
ATGATCAATGAGAAGAACGTAGCGGTAAGCTGATCTCGTGCATGATGCCCACCAGCAGTCATGTCGACCGACGAA
GCTATTATAAGATGTGCGAATAGTACATCTTATCAATTCAACTAGCGCCACACCTCGGCCCGTGACAATCTTCCG
ACGCCGGTCATCCAGGCACCGACGTCTTCGCACCCCAAGGCTGGCTTCAAGGCTGAGAAATCCAACATCCGACTC
CACGCAATTTTCTCCCCATCATAAACCCCATCGTCACCACAACCGATCACACATCCGCAGTTTCCACCATGGTTC
TTCCCCCCTATCTCCTCCCGTATCTCCCTCACCGAAAAGCTAACCGTGAACCCCCCCCCAAAGGCATCGCAGCAA
AGCTCGAGGCAGCGCCTCGCCCTCGCCATCTGTCACTTTCTCAACACGTCGCTCTCGGACGGAACCCTCGCCGCC
GATGAAAAGGACTCCATCGACGTGGCCGTCAGCTGCATCGCCGAATGCTTCAAGGTCGACGCCGCAGATGAGCAG
GCGGTAAAGTCAGCCGTGGGATCGCAGTCGCTGCTGCAAATCTACTCCGTCTACGACAAGCTCAAAGGCAGCGAA
GGCAGCAGCGCAAGTGCCAGCGCCAGCGCCAGCGCCAACACCAGCAAGCCAACCCCCGAGAAGCCCTCGGAGTCG
CAGAAGAAGGAGGCCGAAGCCCTCAAGTCAAAGGGCAACGCCGCCATGGCCCAGAAACAATACCAACAAGCCATA
ACCCTCTACAGCCAAGCCCTCGACCTCGACCCCGCAAACGCAGTCTTCCTCTCCAACCGCGCGGCCGCCCACTCA
GCCGCAAAGGATCACTCTAGCGCAAAGCAGGACGCCGAGGCCGCCGTCGCCATCGACCCTTCCTACACAAAGGCC
TGGTCTCGTCTCGGTCTCGCCCGCTTCGCCCTCGGTGACGCAAAGGGCGCCATGGAAGCCTACGCAAAGGGCATC
GAGCATGAGGGCAACGGCGGATCGGAAGCGATGCGCAAGGGCTTCGAGACGGCCAAGCGTCGCGTCGATGAATCG
GACGGCGCCACAGATGCCGGCGACAATCTCTCTTCTTCCCGCGCCGCGCCCCAGTCTTCTCCTTCGGGCATGCCC
GACTTTGGCTCCATCATGAGCAACCCGATGTTCGCCAGCATGGCCCAGAACCTCATGAGCAACCCGGACCTCATG
TCAAGCCTCATGAGCAACCCGCGCCTGCGCGAGATGGCCGACTCTTTTGGCGCCGGAGGTGCCGGAGGTGGTGGG
ATGCCCGACATTGGCAGCCTCATGTCAGACCCTAACATCGCCGACATGTCAGTCTTTCTCAGTCACCGTCGTCTC
CCTGAGCCTGCTAACTTGACCTAGGGCACGCAATCTCATGGGCGGCGCAAATCCCGGCCAGAACAGGAACAACAA
CAATAACAACTCGCAGCCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail