Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6420
Gene name
LocationContig_7:49360..52214
Strand-
Gene length (bp)2854
Transcript length (bp)2802
Coding sequence length (bp)2802
Protein length (aa) 934

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 1.1E-27 803 925
PF04389 Peptidase_M28 Peptidase family M28 4.6E-14 542 715
PF02225 PA PA domain 1.8E-08 350 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 204 926 6.0E-87
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 201 925 7.0E-84
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 199 925 7.0E-82
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 235 926 7.0E-82
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 199 925 3.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 204 926 6.0E-87
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 201 925 7.0E-84
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 199 925 7.0E-82
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 235 926 7.0E-82
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 199 925 3.0E-80
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 257 926 5.0E-79
sp|O35409|FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus GN=Folh1 PE=1 SV=2 238 925 1.0E-76
sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase 2 OS=Arabidopsis thaliana GN=AMP1 PE=1 SV=3 201 899 6.0E-72
sp|Q9UQQ1|NALDL_HUMAN N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Homo sapiens GN=NAALADL1 PE=1 SV=2 235 925 1.0E-70
sp|Q7M758|NALDL_MOUSE N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Mus musculus GN=Naaladl1 PE=2 SV=1 234 925 1.0E-70
sp|O54697|NALDL_RAT N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Rattus norvegicus GN=Naaladl1 PE=1 SV=1 234 925 2.0E-70
sp|O43023|YGV9_SCHPO Inactive zinc metalloprotease C354.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.09c PE=3 SV=1 116 921 2.0E-68
sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis briggsae GN=CBG08178 PE=3 SV=1 242 783 1.0E-60
sp|P91406|GCP2_CAEEL Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis elegans GN=R57.1 PE=1 SV=2 242 783 8.0E-59
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 197 775 4.0E-55
sp|Q08919|TRE1_YEAST Uncharacterized protein TRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE1 PE=1 SV=1 238 922 3.0E-45
sp|Q9HBA9|FOH1B_HUMAN Putative N-acetylated-alpha-linked acidic dipeptidase OS=Homo sapiens GN=FOLH1B PE=2 SV=1 517 926 4.0E-45
sp|Q9UP52|TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens GN=TFR2 PE=1 SV=1 202 783 7.0E-40
sp|B2GUY2|TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus GN=Tfr2 PE=2 SV=1 237 783 5.0E-37
sp|Q9JKX3|TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus GN=Tfr2 PE=1 SV=2 237 783 2.0E-36
sp|Q08693|TRE2_YEAST Putative zinc metalloprotease TRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE2 PE=1 SV=1 205 926 2.0E-33
sp|Q2V905|TFR1_HORSE Transferrin receptor protein 1 OS=Equus caballus GN=TFRC PE=2 SV=1 237 785 2.0E-32
sp|Q9GLD3|TFR1_CANLF Transferrin receptor protein 1 OS=Canis lupus familiaris GN=TFRC PE=1 SV=1 265 785 6.0E-31
sp|Q8HZV3|TFR1_PIG Transferrin receptor protein 1 OS=Sus scrofa GN=TFRC PE=2 SV=1 265 731 8.0E-31
sp|Q9MYZ3|TFR1_FELCA Transferrin receptor protein 1 OS=Felis catus GN=TFRC PE=1 SV=1 234 665 3.0E-30
sp|Q07891|TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus GN=TFRC PE=2 SV=1 237 665 4.0E-29
sp|Q90997|TFR1_CHICK Transferrin receptor protein 1 OS=Gallus gallus GN=TFRC PE=2 SV=2 340 665 1.0E-28
sp|Q99376|TFR1_RAT Transferrin receptor protein 1 (Fragment) OS=Rattus norvegicus GN=Tfrc PE=2 SV=1 265 715 7.0E-28
sp|Q5RDH6|TFR1_PONAB Transferrin receptor protein 1 OS=Pongo abelii GN=TFRC PE=2 SV=1 237 715 1.0E-27
sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 231 715 2.0E-27
sp|Q58DX5|NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens GN=NAALADL2 PE=1 SV=3 198 767 7.0E-26
sp|Q62351|TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus GN=Tfrc PE=1 SV=1 265 665 1.0E-25
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 204 226 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6420
MAPEKQPFYHPSPPSYDQALAGSSRGASHVAYDNDDDVESLSARHASSQRLSHDDHVPSSPIAESQQLLPVSQPR
ASSSAALIRNNGYRSPTVETDDEESLAGGFGGLGDDDDSDDDAATVRREMEQMDMDEPPSTRGSSWPKMLPGFSL
PSWTWPWPRLPELSRLRQRMAAAFDNDQGQDEDAPRRRWPFNLDEEDKRRLCQVCIRFVVVLVVLTFVVLYITTT
MDVRYRRFDPQDLRQHVMTNVEPMRLRASVMHFSNYAHIAGTEGDYATAMDVESMFSRAGLDRIEVDEYRVYVNY
PRKDGRAVQIMNEAGSEPVWTAKLDEDEVGGETAGRQTYAFHGLSKSGDVRGPLLYANYGTRDDFAHIRDRGIDT
RGAIALVRHRRSSVAPSDAGMQVKAAELAGFAGCLIYTDPADDGFLKGDVAPHGRWMPTDAVRRDSVGLRGWMPG
DVLTPGWESEIKVPRMKVNETTGLVGIPSLPLAWRDAKELLRRLNGHGERVPAGWAGGVPDLSGGWWTGNETSPV
VRLRNEQDEQQQQPIWNVYGKIVGQEQAERAVLVGNHRDSWAFGAGDPHAGTAVMIELARILGGLLARGWRPLRT
IEFMSWDGAAYNLMGSTEFVEKRTDELREAAYAYVNLDGAVSGTKLRAAGSPALQRPLERAMNHVLDSRANATLA
ELWRSKGGRLRGLGAGGDYAALQHTAGTSSLDLAFVIDDDDSKGVPVAHSSYDRLSLIEDVVDPGFAYHVLLAQL
VGVLLLDLADRPVVPFGMKVYADALKEAVSDLDGWIKVRMGDDKKAEREQAVRELADAAALVGQNAQIFDGWELE
WDRNMLETGGRETLELSARRFLYNDRKAAFETALLDLELGGGIPNRTQFKHVVYGPQLWAPSRADVFPAVRDTVE
AGDWPAARRAVAKAAVVLRKAASVLTMDDGQET*
Coding >Ophun1|6420
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCTCATGTCGCGTACGACAACGACGACGACGTTGAGTCGCTTTCAGCACGCCACGCCTCGTCGCAACGC
CTCAGCCACGATGACCATGTGCCCTCGTCACCGATAGCCGAGTCGCAGCAACTCCTACCCGTGAGCCAGCCTCGT
GCCTCGTCTTCGGCTGCCTTGATCCGGAACAACGGATACCGTTCGCCGACGGTGGAGACTGACGATGAAGAGAGC
CTGGCGGGCGGCTTCGGGGGTCTTGGAGACGATGATGACTCTGACGATGATGCAGCCACGGTGCGGCGCGAGATG
GAGCAGATGGACATGGATGAGCCGCCGTCGACACGAGGCTCCTCCTGGCCCAAGATGCTTCCGGGCTTTTCCTTG
CCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCGGCCGCTTTCGAC
AATGACCAAGGTCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTCGACGAGGAAGACAAGAGGCGG
TTGTGCCAAGTCTGCATTCGCTTCGTCGTCGTCCTCGTCGTATTGACGTTTGTCGTTCTCTACATCACCACCACC
ATGGACGTGCGCTACCGCCGATTCGATCCTCAGGACCTCCGCCAACACGTCATGACCAATGTCGAGCCCATGCGT
CTGCGTGCTTCAGTCATGCACTTTTCCAATTATGCCCATATTGCCGGCACCGAGGGCGACTACGCGACTGCCATG
GACGTTGAGAGCATGTTCAGCCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTCTACGTCAACTAT
CCGCGCAAGGACGGACGCGCTGTTCAAATCATGAACGAGGCCGGCTCGGAGCCAGTCTGGACCGCCAAGCTGGAC
GAGGACGAGGTGGGCGGCGAGACGGCCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAGTCGGGCGACGTC
CGGGGCCCCCTCTTGTACGCAAACTACGGAACGCGCGACGACTTTGCCCACATCCGCGACCGGGGAATCGACACG
CGAGGCGCCATTGCGCTGGTGCGTCACCGCCGCAGCTCCGTCGCGCCGTCAGACGCGGGGATGCAGGTCAAGGCG
GCCGAGCTGGCTGGCTTCGCGGGCTGCCTCATATACACGGACCCGGCCGATGACGGCTTCCTCAAGGGCGACGTG
GCACCCCACGGCCGCTGGATGCCGACCGACGCCGTCCGCCGCGATTCGGTCGGTCTCAGGGGCTGGATGCCGGGC
GACGTGTTGACGCCCGGGTGGGAGAGCGAGATCAAGGTGCCGCGGATGAAGGTCAACGAGACGACGGGTCTGGTG
GGCATTCCGAGCCTGCCGCTGGCTTGGCGCGACGCCAAGGAGCTCCTGCGCCGACTCAACGGCCACGGTGAGCGC
GTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGATGGTGGACCGGCAATGAGACGTCGCCCGTG
GTACGACTGCGGAACGAGCAAGACGAGCAGCAGCAGCAGCCCATCTGGAACGTATACGGCAAGATTGTCGGCCAG
GAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGCGACTCTTGGGCGTTTGGCGCCGGCGACCCGCACGCC
GGGACGGCTGTCATGATCGAGCTGGCCCGCATCCTGGGCGGATTGCTCGCCCGCGGGTGGCGGCCGTTGCGGACC
ATCGAGTTCATGTCGTGGGACGGCGCTGCCTACAACCTCATGGGATCGACCGAGTTTGTCGAGAAGCGGACGGAC
GAGCTGCGCGAAGCCGCCTACGCCTACGTCAACCTCGACGGTGCCGTGTCCGGCACGAAGCTCCGGGCCGCGGGC
TCCCCGGCGCTGCAGCGGCCCCTGGAACGGGCAATGAACCACGTGCTGGACTCACGGGCCAACGCAACGCTGGCT
GAGCTGTGGCGCTCCAAAGGCGGCCGCCTCCGCGGACTCGGCGCCGGGGGGGACTATGCGGCGCTGCAACACACG
GCCGGCACCAGCTCGCTCGACCTGGCCTTTGTTATCGACGATGACGACTCCAAGGGCGTGCCCGTCGCGCACTCG
AGCTACGACAGGCTGTCGCTGATCGAGGACGTGGTCGACCCAGGCTTTGCCTACCACGTGCTACTGGCTCAGTTG
GTGGGCGTGCTGCTGCTGGACCTGGCGGATCGGCCGGTGGTGCCGTTTGGGATGAAGGTGTACGCCGACGCGCTG
AAGGAGGCCGTCTCCGATCTCGACGGTTGGATTAAGGTCCGGATGGGCGACGACAAGAAGGCGGAACGGGAGCAG
GCGGTGCGCGAGCTCGCTGATGCCGCCGCGCTGGTGGGCCAGAACGCTCAGATCTTTGACGGCTGGGAGCTCGAA
TGGGACCGAAATATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGTCGGTTCCTATATAACGAC
CGGAAGGCGGCTTTCGAGACGGCGCTGCTAGACTTGGAGTTGGGCGGAGGCATCCCCAACCGCACGCAGTTCAAG
CACGTCGTCTACGGGCCTCAGCTTTGGGCGCCATCCCGCGCGGACGTCTTTCCAGCCGTTCGCGACACGGTTGAG
GCCGGCGACTGGCCAGCGGCGAGGCGGGCTGTAGCCAAGGCAGCGGTCGTCTTGAGAAAGGCGGCTTCGGTGCTG
ACGATGGATGATGGGCAGGAAACTTGA
Transcript >Ophun1|6420
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCTCATGTCGCGTACGACAACGACGACGACGTTGAGTCGCTTTCAGCACGCCACGCCTCGTCGCAACGC
CTCAGCCACGATGACCATGTGCCCTCGTCACCGATAGCCGAGTCGCAGCAACTCCTACCCGTGAGCCAGCCTCGT
GCCTCGTCTTCGGCTGCCTTGATCCGGAACAACGGATACCGTTCGCCGACGGTGGAGACTGACGATGAAGAGAGC
CTGGCGGGCGGCTTCGGGGGTCTTGGAGACGATGATGACTCTGACGATGATGCAGCCACGGTGCGGCGCGAGATG
GAGCAGATGGACATGGATGAGCCGCCGTCGACACGAGGCTCCTCCTGGCCCAAGATGCTTCCGGGCTTTTCCTTG
CCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCGGCCGCTTTCGAC
AATGACCAAGGTCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTCGACGAGGAAGACAAGAGGCGG
TTGTGCCAAGTCTGCATTCGCTTCGTCGTCGTCCTCGTCGTATTGACGTTTGTCGTTCTCTACATCACCACCACC
ATGGACGTGCGCTACCGCCGATTCGATCCTCAGGACCTCCGCCAACACGTCATGACCAATGTCGAGCCCATGCGT
CTGCGTGCTTCAGTCATGCACTTTTCCAATTATGCCCATATTGCCGGCACCGAGGGCGACTACGCGACTGCCATG
GACGTTGAGAGCATGTTCAGCCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTCTACGTCAACTAT
CCGCGCAAGGACGGACGCGCTGTTCAAATCATGAACGAGGCCGGCTCGGAGCCAGTCTGGACCGCCAAGCTGGAC
GAGGACGAGGTGGGCGGCGAGACGGCCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAGTCGGGCGACGTC
CGGGGCCCCCTCTTGTACGCAAACTACGGAACGCGCGACGACTTTGCCCACATCCGCGACCGGGGAATCGACACG
CGAGGCGCCATTGCGCTGGTGCGTCACCGCCGCAGCTCCGTCGCGCCGTCAGACGCGGGGATGCAGGTCAAGGCG
GCCGAGCTGGCTGGCTTCGCGGGCTGCCTCATATACACGGACCCGGCCGATGACGGCTTCCTCAAGGGCGACGTG
GCACCCCACGGCCGCTGGATGCCGACCGACGCCGTCCGCCGCGATTCGGTCGGTCTCAGGGGCTGGATGCCGGGC
GACGTGTTGACGCCCGGGTGGGAGAGCGAGATCAAGGTGCCGCGGATGAAGGTCAACGAGACGACGGGTCTGGTG
GGCATTCCGAGCCTGCCGCTGGCTTGGCGCGACGCCAAGGAGCTCCTGCGCCGACTCAACGGCCACGGTGAGCGC
GTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGATGGTGGACCGGCAATGAGACGTCGCCCGTG
GTACGACTGCGGAACGAGCAAGACGAGCAGCAGCAGCAGCCCATCTGGAACGTATACGGCAAGATTGTCGGCCAG
GAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGCGACTCTTGGGCGTTTGGCGCCGGCGACCCGCACGCC
GGGACGGCTGTCATGATCGAGCTGGCCCGCATCCTGGGCGGATTGCTCGCCCGCGGGTGGCGGCCGTTGCGGACC
ATCGAGTTCATGTCGTGGGACGGCGCTGCCTACAACCTCATGGGATCGACCGAGTTTGTCGAGAAGCGGACGGAC
GAGCTGCGCGAAGCCGCCTACGCCTACGTCAACCTCGACGGTGCCGTGTCCGGCACGAAGCTCCGGGCCGCGGGC
TCCCCGGCGCTGCAGCGGCCCCTGGAACGGGCAATGAACCACGTGCTGGACTCACGGGCCAACGCAACGCTGGCT
GAGCTGTGGCGCTCCAAAGGCGGCCGCCTCCGCGGACTCGGCGCCGGGGGGGACTATGCGGCGCTGCAACACACG
GCCGGCACCAGCTCGCTCGACCTGGCCTTTGTTATCGACGATGACGACTCCAAGGGCGTGCCCGTCGCGCACTCG
AGCTACGACAGGCTGTCGCTGATCGAGGACGTGGTCGACCCAGGCTTTGCCTACCACGTGCTACTGGCTCAGTTG
GTGGGCGTGCTGCTGCTGGACCTGGCGGATCGGCCGGTGGTGCCGTTTGGGATGAAGGTGTACGCCGACGCGCTG
AAGGAGGCCGTCTCCGATCTCGACGGTTGGATTAAGGTCCGGATGGGCGACGACAAGAAGGCGGAACGGGAGCAG
GCGGTGCGCGAGCTCGCTGATGCCGCCGCGCTGGTGGGCCAGAACGCTCAGATCTTTGACGGCTGGGAGCTCGAA
TGGGACCGAAATATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGTCGGTTCCTATATAACGAC
CGGAAGGCGGCTTTCGAGACGGCGCTGCTAGACTTGGAGTTGGGCGGAGGCATCCCCAACCGCACGCAGTTCAAG
CACGTCGTCTACGGGCCTCAGCTTTGGGCGCCATCCCGCGCGGACGTCTTTCCAGCCGTTCGCGACACGGTTGAG
GCCGGCGACTGGCCAGCGGCGAGGCGGGCTGTAGCCAAGGCAGCGGTCGTCTTGAGAAAGGCGGCTTCGGTGCTG
ACGATGGATGATGGGCAGGAAACTTGA
Gene >Ophun1|6420
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCTCATGTCGCGTACGACAACGACGACGACGTTGAGTCGCTTTCAGCACGCCACGCCTCGTCGCAACGC
CTCAGCCACGATGACCATGTGCCCTCGTCACCGATAGCCGAGTCGCAGCAACTCCTACCCGTGAGCCAGCCTCGT
GCCTCGTCTTCGGCTGCCTTGATCCGGAACAACGGATACCGTTCGCCGACGGTGGAGACTGACGATGAAGAGAGC
CTGGCGGGCGGCTTCGGGGGTCTTGGAGACGATGATGACTCTGACGATGATGCAGCCACGGTGCGGCGCGAGATG
GAGCAGATGGACATGGATGAGCCGCCGTCGACACGAGGCTCCTCCTGGCCCAAGATGCTTCCGGGCTTTTCCTTG
CCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCGGCCGCTTTCGAC
AATGACCAAGGTCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTCGACGAGGAAGACAAGAGGCGG
TTGTGCCAAGTCTGCATTCGCTTCGTCGTCGTCCTCGTCGTATTGACGTTTGTCGTTCTCTACATCACCACCACC
ATGGACGTGCGCTACCGCCGATTCGATCCTCAGGACCTCCGCCAACACGTCATGACCAATGTCGAGCCCATGCGT
CTGCGTGCTTCAGTCATGCACTTTTCCAATTATGCCCATATTGCCGGCACCGAGGGCGACTACGCGACTGCCATG
GACGTTGAGAGCATGTTCAGCCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTCTACGTCAACTAT
CCGCGCAAGGACGGACGCGCTGTTCAAATCATGAACGAGGCCGGCTCGGAGCCAGTCTGGACCGCCAAGCTGGAC
GAGGACGAGGTGGGCGGCGAGACGGCCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAGTCGGGCGACGTC
CGGGGCCCCCTCTTGTACGCAAACTACGGAACGCGCGACGACTTTGCCCACATCCGCGACCGGGGAATCGACACG
CGAGGCGCCATTGCGCTGGTGCGTCACCGCCGCAGCTCCGTCGCGCCGTCAGACGCGGGGATGCAGGTCAAGGCG
GCCGAGCTGGCTGGCTTCGCGGGCTGCCTCATATACACGGACCCGGCCGATGACGGCTTCCTCAAGGGCGACGTG
GCACCCCACGGCCGCTGGATGCCGACCGACGCCGTCCGCCGCGATTCGGTCGGTCTCAGGGGCTGGATGCCGGGC
GACGTGTTGACGCCCGGGTGGGAGAGCGAGATCAAGGTGCCGCGGATGAAGGTCAACGAGACGACGGGTCTGGTG
GGCATTCCGAGCCTGCCGCTGGCTTGGCGCGACGCCAAGGAGCTCCTGCGCCGACTCAACGGCCACGGTGAGCGC
GTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGATGGTGGACCGGCAATGAGACGTCGCCCGTG
GTACGACTGCGGAACGAGCAAGACGAGCAGCAGCAGCAGCCCATCTGGAACGTATACGGCAAGATTGTCGGCCAG
GAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGCGACTCTTGGGCGTTTGGCGCCGGCGACCCGCACGCC
GGGACGGCTGTCATGATCGAGCTGGCCCGCATCCTGGGCGGATTGCTCGCCCGCGGGTGGCGGCCGTTGCGGACC
ATCGAGTTCATGTCGTGGGACGGCGCTGCCTACAACCTCATGGGATCGACCGAGTTTGTCGAGAAGCGGACGGAC
GAGCTGCGCGAAGCCGCCTACGCCTACGTCAACCTCGACGGTGCCGTGTCCGGCACGAAGCTCCGGGCCGCGGGC
TCCCCGGCGCTGCAGCGGCCCCTGGAACGGGCAATGAACCACGTGCTGGACTCACGGGCCAACGCAACGCTGGCT
GAGCTGTGGCGCTCCAAAGGCGGCCGCCTCCGCGGACTCGGCGCCGGGGGGGACTATGCGGCGCTGCAACACACG
GCCGGCACCAGCTCGCTCGACCTGGCCTTTGTTATCGACGATGACGACTCCAAGGGCGTGCCCGTCGCGCACTCG
AGCTACGACAGGCTGTCGCTGATCGAGGACGTGGTCGACCCAGGCTTTGCCTACCACGTGCTACTGGCTCAGTTG
GTGGGCGTGCTGCTGCTGGACCTGGCGGATCGGCCGGTGGTGCCGTTTGGGATGAAGGTGTACGCCGACGCGCTG
AAGGAGGCCGTCTCCGATCTCGACGGTTGGATTAAGGTCCGGATGGGCGACGACAAGAAGGCGGAACGGGAGCAG
GCGGTGCGCGAGCTCGCTGATGCCGCCGCGCTGGTGGGCCAGAACGCTCAGATCTTTGACGGCTGGGAGCTCGAA
TGGGACCGAAATATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGTCGGTTCCTATATAACGAC
CGGAAGGCGGCTTTCGAGACGGCGCTGCTAGACTTGGAGTTGGGCGGAGGCGTGAGTTTCCTTTTTTCTCCGCCC
CCGTATACGCAGCTCATGTCCTTTCTAGATCCCCAACCGCACGCAGTTCAAGCACGTCGTCTACGGGCCTCAGCT
TTGGGCGCCATCCCGCGCGGACGTCTTTCCAGCCGTTCGCGACACGGTTGAGGCCGGCGACTGGCCAGCGGCGAG
GCGGGCTGTAGCCAAGGCAGCGGTCGTCTTGAGAAAGGCGGCTTCGGTGCTGACGATGGATGATGGGCAGGAAAC
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail