Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6420
Gene name
LocationContig_7:49360..52214
Strand-
Gene length (bp)2854
Transcript length (bp)2802
Coding sequence length (bp)2802
Protein length (aa) 934

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 1.1E-27 803 925
PF04389 Peptidase_M28 Peptidase family M28 4.6E-14 542 715
PF02225 PA PA domain 1.8E-08 350 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 204 926 6.0E-87
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 201 925 7.0E-84
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 199 925 7.0E-82
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 235 926 7.0E-82
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 199 925 3.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 204 926 6.0E-87
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 201 925 7.0E-84
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 199 925 7.0E-82
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 235 926 7.0E-82
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 199 925 3.0E-80
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 257 926 5.0E-79
sp|O35409|FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus GN=Folh1 PE=1 SV=2 238 925 1.0E-76
sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase 2 OS=Arabidopsis thaliana GN=AMP1 PE=1 SV=3 201 899 6.0E-72
sp|Q9UQQ1|NALDL_HUMAN N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Homo sapiens GN=NAALADL1 PE=1 SV=2 235 925 1.0E-70
sp|Q7M758|NALDL_MOUSE N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Mus musculus GN=Naaladl1 PE=2 SV=1 234 925 1.0E-70
sp|O54697|NALDL_RAT N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Rattus norvegicus GN=Naaladl1 PE=1 SV=1 234 925 2.0E-70
sp|O43023|YGV9_SCHPO Inactive zinc metalloprotease C354.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.09c PE=3 SV=1 116 921 2.0E-68
sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis briggsae GN=CBG08178 PE=3 SV=1 242 783 1.0E-60
sp|P91406|GCP2_CAEEL Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis elegans GN=R57.1 PE=1 SV=2 242 783 8.0E-59
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 197 775 4.0E-55
sp|Q08919|TRE1_YEAST Uncharacterized protein TRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE1 PE=1 SV=1 238 922 3.0E-45
sp|Q9HBA9|FOH1B_HUMAN Putative N-acetylated-alpha-linked acidic dipeptidase OS=Homo sapiens GN=FOLH1B PE=2 SV=1 517 926 4.0E-45
sp|Q9UP52|TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens GN=TFR2 PE=1 SV=1 202 783 7.0E-40
sp|B2GUY2|TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus GN=Tfr2 PE=2 SV=1 237 783 5.0E-37
sp|Q9JKX3|TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus GN=Tfr2 PE=1 SV=2 237 783 2.0E-36
sp|Q08693|TRE2_YEAST Putative zinc metalloprotease TRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE2 PE=1 SV=1 205 926 2.0E-33
sp|Q2V905|TFR1_HORSE Transferrin receptor protein 1 OS=Equus caballus GN=TFRC PE=2 SV=1 237 785 2.0E-32
sp|Q9GLD3|TFR1_CANLF Transferrin receptor protein 1 OS=Canis lupus familiaris GN=TFRC PE=1 SV=1 265 785 6.0E-31
sp|Q8HZV3|TFR1_PIG Transferrin receptor protein 1 OS=Sus scrofa GN=TFRC PE=2 SV=1 265 731 8.0E-31
sp|Q9MYZ3|TFR1_FELCA Transferrin receptor protein 1 OS=Felis catus GN=TFRC PE=1 SV=1 234 665 3.0E-30
sp|Q07891|TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus GN=TFRC PE=2 SV=1 237 665 4.0E-29
sp|Q90997|TFR1_CHICK Transferrin receptor protein 1 OS=Gallus gallus GN=TFRC PE=2 SV=2 340 665 1.0E-28
sp|Q99376|TFR1_RAT Transferrin receptor protein 1 (Fragment) OS=Rattus norvegicus GN=Tfrc PE=2 SV=1 265 715 7.0E-28
sp|Q5RDH6|TFR1_PONAB Transferrin receptor protein 1 OS=Pongo abelii GN=TFRC PE=2 SV=1 237 715 1.0E-27
sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 231 715 2.0E-27
sp|Q58DX5|NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens GN=NAALADL2 PE=1 SV=3 198 767 7.0E-26
sp|Q62351|TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus GN=Tfrc PE=1 SV=1 265 665 1.0E-25
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 204 226 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4186
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5157
Ophiocordyceps australis map64 (Brazil) OphauB2|8090
Ophiocordyceps camponoti-floridani Ophcf2|04694
Ophiocordyceps camponoti-rufipedis Ophun1|6420 (this protein)
Ophiocordyceps kimflemingae Ophio5|6728
Ophiocordyceps subramaniannii Hirsu2|8503

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6420
MAPEKQPFYHPSPPSYDQALAGSSRGASHVAYDNDDDVESLSARHASSQRLSHDDHVPSSPIAESQQLLPVSQPR
ASSSAALIRNNGYRSPTVETDDEESLAGGFGGLGDDDDSDDDAATVRREMEQMDMDEPPSTRGSSWPKMLPGFSL
PSWTWPWPRLPELSRLRQRMAAAFDNDQGQDEDAPRRRWPFNLDEEDKRRLCQVCIRFVVVLVVLTFVVLYITTT
MDVRYRRFDPQDLRQHVMTNVEPMRLRASVMHFSNYAHIAGTEGDYATAMDVESMFSRAGLDRIEVDEYRVYVNY
PRKDGRAVQIMNEAGSEPVWTAKLDEDEVGGETAGRQTYAFHGLSKSGDVRGPLLYANYGTRDDFAHIRDRGIDT
RGAIALVRHRRSSVAPSDAGMQVKAAELAGFAGCLIYTDPADDGFLKGDVAPHGRWMPTDAVRRDSVGLRGWMPG
DVLTPGWESEIKVPRMKVNETTGLVGIPSLPLAWRDAKELLRRLNGHGERVPAGWAGGVPDLSGGWWTGNETSPV
VRLRNEQDEQQQQPIWNVYGKIVGQEQAERAVLVGNHRDSWAFGAGDPHAGTAVMIELARILGGLLARGWRPLRT
IEFMSWDGAAYNLMGSTEFVEKRTDELREAAYAYVNLDGAVSGTKLRAAGSPALQRPLERAMNHVLDSRANATLA
ELWRSKGGRLRGLGAGGDYAALQHTAGTSSLDLAFVIDDDDSKGVPVAHSSYDRLSLIEDVVDPGFAYHVLLAQL
VGVLLLDLADRPVVPFGMKVYADALKEAVSDLDGWIKVRMGDDKKAEREQAVRELADAAALVGQNAQIFDGWELE
WDRNMLETGGRETLELSARRFLYNDRKAAFETALLDLELGGGIPNRTQFKHVVYGPQLWAPSRADVFPAVRDTVE
AGDWPAARRAVAKAAVVLRKAASVLTMDDGQET*
Coding >Ophun1|6420
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCTCATGTCGCGTACGACAACGACGACGACGTTGAGTCGCTTTCAGCACGCCACGCCTCGTCGCAACGC
CTCAGCCACGATGACCATGTGCCCTCGTCACCGATAGCCGAGTCGCAGCAACTCCTACCCGTGAGCCAGCCTCGT
GCCTCGTCTTCGGCTGCCTTGATCCGGAACAACGGATACCGTTCGCCGACGGTGGAGACTGACGATGAAGAGAGC
CTGGCGGGCGGCTTCGGGGGTCTTGGAGACGATGATGACTCTGACGATGATGCAGCCACGGTGCGGCGCGAGATG
GAGCAGATGGACATGGATGAGCCGCCGTCGACACGAGGCTCCTCCTGGCCCAAGATGCTTCCGGGCTTTTCCTTG
CCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCGGCCGCTTTCGAC
AATGACCAAGGTCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTCGACGAGGAAGACAAGAGGCGG
TTGTGCCAAGTCTGCATTCGCTTCGTCGTCGTCCTCGTCGTATTGACGTTTGTCGTTCTCTACATCACCACCACC
ATGGACGTGCGCTACCGCCGATTCGATCCTCAGGACCTCCGCCAACACGTCATGACCAATGTCGAGCCCATGCGT
CTGCGTGCTTCAGTCATGCACTTTTCCAATTATGCCCATATTGCCGGCACCGAGGGCGACTACGCGACTGCCATG
GACGTTGAGAGCATGTTCAGCCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTCTACGTCAACTAT
CCGCGCAAGGACGGACGCGCTGTTCAAATCATGAACGAGGCCGGCTCGGAGCCAGTCTGGACCGCCAAGCTGGAC
GAGGACGAGGTGGGCGGCGAGACGGCCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAGTCGGGCGACGTC
CGGGGCCCCCTCTTGTACGCAAACTACGGAACGCGCGACGACTTTGCCCACATCCGCGACCGGGGAATCGACACG
CGAGGCGCCATTGCGCTGGTGCGTCACCGCCGCAGCTCCGTCGCGCCGTCAGACGCGGGGATGCAGGTCAAGGCG
GCCGAGCTGGCTGGCTTCGCGGGCTGCCTCATATACACGGACCCGGCCGATGACGGCTTCCTCAAGGGCGACGTG
GCACCCCACGGCCGCTGGATGCCGACCGACGCCGTCCGCCGCGATTCGGTCGGTCTCAGGGGCTGGATGCCGGGC
GACGTGTTGACGCCCGGGTGGGAGAGCGAGATCAAGGTGCCGCGGATGAAGGTCAACGAGACGACGGGTCTGGTG
GGCATTCCGAGCCTGCCGCTGGCTTGGCGCGACGCCAAGGAGCTCCTGCGCCGACTCAACGGCCACGGTGAGCGC
GTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGATGGTGGACCGGCAATGAGACGTCGCCCGTG
GTACGACTGCGGAACGAGCAAGACGAGCAGCAGCAGCAGCCCATCTGGAACGTATACGGCAAGATTGTCGGCCAG
GAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGCGACTCTTGGGCGTTTGGCGCCGGCGACCCGCACGCC
GGGACGGCTGTCATGATCGAGCTGGCCCGCATCCTGGGCGGATTGCTCGCCCGCGGGTGGCGGCCGTTGCGGACC
ATCGAGTTCATGTCGTGGGACGGCGCTGCCTACAACCTCATGGGATCGACCGAGTTTGTCGAGAAGCGGACGGAC
GAGCTGCGCGAAGCCGCCTACGCCTACGTCAACCTCGACGGTGCCGTGTCCGGCACGAAGCTCCGGGCCGCGGGC
TCCCCGGCGCTGCAGCGGCCCCTGGAACGGGCAATGAACCACGTGCTGGACTCACGGGCCAACGCAACGCTGGCT
GAGCTGTGGCGCTCCAAAGGCGGCCGCCTCCGCGGACTCGGCGCCGGGGGGGACTATGCGGCGCTGCAACACACG
GCCGGCACCAGCTCGCTCGACCTGGCCTTTGTTATCGACGATGACGACTCCAAGGGCGTGCCCGTCGCGCACTCG
AGCTACGACAGGCTGTCGCTGATCGAGGACGTGGTCGACCCAGGCTTTGCCTACCACGTGCTACTGGCTCAGTTG
GTGGGCGTGCTGCTGCTGGACCTGGCGGATCGGCCGGTGGTGCCGTTTGGGATGAAGGTGTACGCCGACGCGCTG
AAGGAGGCCGTCTCCGATCTCGACGGTTGGATTAAGGTCCGGATGGGCGACGACAAGAAGGCGGAACGGGAGCAG
GCGGTGCGCGAGCTCGCTGATGCCGCCGCGCTGGTGGGCCAGAACGCTCAGATCTTTGACGGCTGGGAGCTCGAA
TGGGACCGAAATATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGTCGGTTCCTATATAACGAC
CGGAAGGCGGCTTTCGAGACGGCGCTGCTAGACTTGGAGTTGGGCGGAGGCATCCCCAACCGCACGCAGTTCAAG
CACGTCGTCTACGGGCCTCAGCTTTGGGCGCCATCCCGCGCGGACGTCTTTCCAGCCGTTCGCGACACGGTTGAG
GCCGGCGACTGGCCAGCGGCGAGGCGGGCTGTAGCCAAGGCAGCGGTCGTCTTGAGAAAGGCGGCTTCGGTGCTG
ACGATGGATGATGGGCAGGAAACTTGA
Transcript >Ophun1|6420
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCTCATGTCGCGTACGACAACGACGACGACGTTGAGTCGCTTTCAGCACGCCACGCCTCGTCGCAACGC
CTCAGCCACGATGACCATGTGCCCTCGTCACCGATAGCCGAGTCGCAGCAACTCCTACCCGTGAGCCAGCCTCGT
GCCTCGTCTTCGGCTGCCTTGATCCGGAACAACGGATACCGTTCGCCGACGGTGGAGACTGACGATGAAGAGAGC
CTGGCGGGCGGCTTCGGGGGTCTTGGAGACGATGATGACTCTGACGATGATGCAGCCACGGTGCGGCGCGAGATG
GAGCAGATGGACATGGATGAGCCGCCGTCGACACGAGGCTCCTCCTGGCCCAAGATGCTTCCGGGCTTTTCCTTG
CCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCGGCCGCTTTCGAC
AATGACCAAGGTCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTCGACGAGGAAGACAAGAGGCGG
TTGTGCCAAGTCTGCATTCGCTTCGTCGTCGTCCTCGTCGTATTGACGTTTGTCGTTCTCTACATCACCACCACC
ATGGACGTGCGCTACCGCCGATTCGATCCTCAGGACCTCCGCCAACACGTCATGACCAATGTCGAGCCCATGCGT
CTGCGTGCTTCAGTCATGCACTTTTCCAATTATGCCCATATTGCCGGCACCGAGGGCGACTACGCGACTGCCATG
GACGTTGAGAGCATGTTCAGCCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTCTACGTCAACTAT
CCGCGCAAGGACGGACGCGCTGTTCAAATCATGAACGAGGCCGGCTCGGAGCCAGTCTGGACCGCCAAGCTGGAC
GAGGACGAGGTGGGCGGCGAGACGGCCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAGTCGGGCGACGTC
CGGGGCCCCCTCTTGTACGCAAACTACGGAACGCGCGACGACTTTGCCCACATCCGCGACCGGGGAATCGACACG
CGAGGCGCCATTGCGCTGGTGCGTCACCGCCGCAGCTCCGTCGCGCCGTCAGACGCGGGGATGCAGGTCAAGGCG
GCCGAGCTGGCTGGCTTCGCGGGCTGCCTCATATACACGGACCCGGCCGATGACGGCTTCCTCAAGGGCGACGTG
GCACCCCACGGCCGCTGGATGCCGACCGACGCCGTCCGCCGCGATTCGGTCGGTCTCAGGGGCTGGATGCCGGGC
GACGTGTTGACGCCCGGGTGGGAGAGCGAGATCAAGGTGCCGCGGATGAAGGTCAACGAGACGACGGGTCTGGTG
GGCATTCCGAGCCTGCCGCTGGCTTGGCGCGACGCCAAGGAGCTCCTGCGCCGACTCAACGGCCACGGTGAGCGC
GTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGATGGTGGACCGGCAATGAGACGTCGCCCGTG
GTACGACTGCGGAACGAGCAAGACGAGCAGCAGCAGCAGCCCATCTGGAACGTATACGGCAAGATTGTCGGCCAG
GAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGCGACTCTTGGGCGTTTGGCGCCGGCGACCCGCACGCC
GGGACGGCTGTCATGATCGAGCTGGCCCGCATCCTGGGCGGATTGCTCGCCCGCGGGTGGCGGCCGTTGCGGACC
ATCGAGTTCATGTCGTGGGACGGCGCTGCCTACAACCTCATGGGATCGACCGAGTTTGTCGAGAAGCGGACGGAC
GAGCTGCGCGAAGCCGCCTACGCCTACGTCAACCTCGACGGTGCCGTGTCCGGCACGAAGCTCCGGGCCGCGGGC
TCCCCGGCGCTGCAGCGGCCCCTGGAACGGGCAATGAACCACGTGCTGGACTCACGGGCCAACGCAACGCTGGCT
GAGCTGTGGCGCTCCAAAGGCGGCCGCCTCCGCGGACTCGGCGCCGGGGGGGACTATGCGGCGCTGCAACACACG
GCCGGCACCAGCTCGCTCGACCTGGCCTTTGTTATCGACGATGACGACTCCAAGGGCGTGCCCGTCGCGCACTCG
AGCTACGACAGGCTGTCGCTGATCGAGGACGTGGTCGACCCAGGCTTTGCCTACCACGTGCTACTGGCTCAGTTG
GTGGGCGTGCTGCTGCTGGACCTGGCGGATCGGCCGGTGGTGCCGTTTGGGATGAAGGTGTACGCCGACGCGCTG
AAGGAGGCCGTCTCCGATCTCGACGGTTGGATTAAGGTCCGGATGGGCGACGACAAGAAGGCGGAACGGGAGCAG
GCGGTGCGCGAGCTCGCTGATGCCGCCGCGCTGGTGGGCCAGAACGCTCAGATCTTTGACGGCTGGGAGCTCGAA
TGGGACCGAAATATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGTCGGTTCCTATATAACGAC
CGGAAGGCGGCTTTCGAGACGGCGCTGCTAGACTTGGAGTTGGGCGGAGGCATCCCCAACCGCACGCAGTTCAAG
CACGTCGTCTACGGGCCTCAGCTTTGGGCGCCATCCCGCGCGGACGTCTTTCCAGCCGTTCGCGACACGGTTGAG
GCCGGCGACTGGCCAGCGGCGAGGCGGGCTGTAGCCAAGGCAGCGGTCGTCTTGAGAAAGGCGGCTTCGGTGCTG
ACGATGGATGATGGGCAGGAAACTTGA
Gene >Ophun1|6420
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCTCATGTCGCGTACGACAACGACGACGACGTTGAGTCGCTTTCAGCACGCCACGCCTCGTCGCAACGC
CTCAGCCACGATGACCATGTGCCCTCGTCACCGATAGCCGAGTCGCAGCAACTCCTACCCGTGAGCCAGCCTCGT
GCCTCGTCTTCGGCTGCCTTGATCCGGAACAACGGATACCGTTCGCCGACGGTGGAGACTGACGATGAAGAGAGC
CTGGCGGGCGGCTTCGGGGGTCTTGGAGACGATGATGACTCTGACGATGATGCAGCCACGGTGCGGCGCGAGATG
GAGCAGATGGACATGGATGAGCCGCCGTCGACACGAGGCTCCTCCTGGCCCAAGATGCTTCCGGGCTTTTCCTTG
CCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCGGCCGCTTTCGAC
AATGACCAAGGTCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTCGACGAGGAAGACAAGAGGCGG
TTGTGCCAAGTCTGCATTCGCTTCGTCGTCGTCCTCGTCGTATTGACGTTTGTCGTTCTCTACATCACCACCACC
ATGGACGTGCGCTACCGCCGATTCGATCCTCAGGACCTCCGCCAACACGTCATGACCAATGTCGAGCCCATGCGT
CTGCGTGCTTCAGTCATGCACTTTTCCAATTATGCCCATATTGCCGGCACCGAGGGCGACTACGCGACTGCCATG
GACGTTGAGAGCATGTTCAGCCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTCTACGTCAACTAT
CCGCGCAAGGACGGACGCGCTGTTCAAATCATGAACGAGGCCGGCTCGGAGCCAGTCTGGACCGCCAAGCTGGAC
GAGGACGAGGTGGGCGGCGAGACGGCCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAGTCGGGCGACGTC
CGGGGCCCCCTCTTGTACGCAAACTACGGAACGCGCGACGACTTTGCCCACATCCGCGACCGGGGAATCGACACG
CGAGGCGCCATTGCGCTGGTGCGTCACCGCCGCAGCTCCGTCGCGCCGTCAGACGCGGGGATGCAGGTCAAGGCG
GCCGAGCTGGCTGGCTTCGCGGGCTGCCTCATATACACGGACCCGGCCGATGACGGCTTCCTCAAGGGCGACGTG
GCACCCCACGGCCGCTGGATGCCGACCGACGCCGTCCGCCGCGATTCGGTCGGTCTCAGGGGCTGGATGCCGGGC
GACGTGTTGACGCCCGGGTGGGAGAGCGAGATCAAGGTGCCGCGGATGAAGGTCAACGAGACGACGGGTCTGGTG
GGCATTCCGAGCCTGCCGCTGGCTTGGCGCGACGCCAAGGAGCTCCTGCGCCGACTCAACGGCCACGGTGAGCGC
GTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGATGGTGGACCGGCAATGAGACGTCGCCCGTG
GTACGACTGCGGAACGAGCAAGACGAGCAGCAGCAGCAGCCCATCTGGAACGTATACGGCAAGATTGTCGGCCAG
GAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGCGACTCTTGGGCGTTTGGCGCCGGCGACCCGCACGCC
GGGACGGCTGTCATGATCGAGCTGGCCCGCATCCTGGGCGGATTGCTCGCCCGCGGGTGGCGGCCGTTGCGGACC
ATCGAGTTCATGTCGTGGGACGGCGCTGCCTACAACCTCATGGGATCGACCGAGTTTGTCGAGAAGCGGACGGAC
GAGCTGCGCGAAGCCGCCTACGCCTACGTCAACCTCGACGGTGCCGTGTCCGGCACGAAGCTCCGGGCCGCGGGC
TCCCCGGCGCTGCAGCGGCCCCTGGAACGGGCAATGAACCACGTGCTGGACTCACGGGCCAACGCAACGCTGGCT
GAGCTGTGGCGCTCCAAAGGCGGCCGCCTCCGCGGACTCGGCGCCGGGGGGGACTATGCGGCGCTGCAACACACG
GCCGGCACCAGCTCGCTCGACCTGGCCTTTGTTATCGACGATGACGACTCCAAGGGCGTGCCCGTCGCGCACTCG
AGCTACGACAGGCTGTCGCTGATCGAGGACGTGGTCGACCCAGGCTTTGCCTACCACGTGCTACTGGCTCAGTTG
GTGGGCGTGCTGCTGCTGGACCTGGCGGATCGGCCGGTGGTGCCGTTTGGGATGAAGGTGTACGCCGACGCGCTG
AAGGAGGCCGTCTCCGATCTCGACGGTTGGATTAAGGTCCGGATGGGCGACGACAAGAAGGCGGAACGGGAGCAG
GCGGTGCGCGAGCTCGCTGATGCCGCCGCGCTGGTGGGCCAGAACGCTCAGATCTTTGACGGCTGGGAGCTCGAA
TGGGACCGAAATATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGTCGGTTCCTATATAACGAC
CGGAAGGCGGCTTTCGAGACGGCGCTGCTAGACTTGGAGTTGGGCGGAGGCGTGAGTTTCCTTTTTTCTCCGCCC
CCGTATACGCAGCTCATGTCCTTTCTAGATCCCCAACCGCACGCAGTTCAAGCACGTCGTCTACGGGCCTCAGCT
TTGGGCGCCATCCCGCGCGGACGTCTTTCCAGCCGTTCGCGACACGGTTGAGGCCGGCGACTGGCCAGCGGCGAG
GCGGGCTGTAGCCAAGGCAGCGGTCGTCTTGAGAAAGGCGGCTTCGGTGCTGACGATGGATGATGGGCAGGAAAC
TTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail