Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6418
Gene name
LocationContig_7:45606..47288
Strand+
Gene length (bp)1682
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04280 Tim44 Tim44-like domain 1.3E-34 382 535

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60084|TIM44_SCHPO Mitochondrial import inner membrane translocase subunit tim44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim44 PE=3 SV=1 160 536 1.0E-102
sp|Q01852|TIM44_YEAST Mitochondrial import inner membrane translocase subunit TIM44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM44 PE=1 SV=1 160 537 3.0E-88
sp|O35857|TIM44_MOUSE Mitochondrial import inner membrane translocase subunit TIM44 OS=Mus musculus GN=Timm44 PE=1 SV=2 166 536 9.0E-43
sp|O43615|TIM44_HUMAN Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens GN=TIMM44 PE=1 SV=2 166 536 3.0E-41
sp|O35094|TIM44_RAT Mitochondrial import inner membrane translocase subunit TIM44 OS=Rattus norvegicus GN=Timm44 PE=1 SV=1 166 536 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60084|TIM44_SCHPO Mitochondrial import inner membrane translocase subunit tim44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim44 PE=3 SV=1 160 536 1.0E-102
sp|Q01852|TIM44_YEAST Mitochondrial import inner membrane translocase subunit TIM44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM44 PE=1 SV=1 160 537 3.0E-88
sp|O35857|TIM44_MOUSE Mitochondrial import inner membrane translocase subunit TIM44 OS=Mus musculus GN=Timm44 PE=1 SV=2 166 536 9.0E-43
sp|O43615|TIM44_HUMAN Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens GN=TIMM44 PE=1 SV=2 166 536 3.0E-41
sp|O35094|TIM44_RAT Mitochondrial import inner membrane translocase subunit TIM44 OS=Rattus norvegicus GN=Timm44 PE=1 SV=1 166 536 1.0E-40
sp|O02161|TIM44_CAEEL Probable mitochondrial import inner membrane translocase subunit tin-44 OS=Caenorhabditis elegans GN=tin-44 PE=3 SV=1 166 534 4.0E-34
sp|Q5XF06|TI442_ARATH Mitochondrial import inner membrane translocase subunit TIM44-2 OS=Arabidopsis thaliana GN=TIM44-2 PE=1 SV=1 350 537 1.0E-16
sp|Q1PF33|TI441_ARATH Mitochondrial import inner membrane translocase subunit TIM44-1 OS=Arabidopsis thaliana GN=TIM44-1 PE=2 SV=1 350 537 1.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1000
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3013
Ophiocordyceps australis 1348a (Ghana) OphauG2|3060
Ophiocordyceps australis map64 (Brazil) OphauB2|8092
Ophiocordyceps camponoti-floridani Ophcf2|04696
Ophiocordyceps camponoti-rufipedis Ophun1|6418 (this protein)
Ophiocordyceps kimflemingae Ophio5|6726
Ophiocordyceps subramaniannii Hirsu2|8500

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6418
MPSLVRSAPSTACALSRTTARPAHAYGRSPAYRRLASQLPRHRSSLQPLSRTLTPAPLSFRQFHLTGKFQQETKP
GSAEAPKPTEKPVPKPKGEESAAKGTDAAEDGNQQKPATEDPAAKGTKNAQDGDQQKTEGEENKSGDKDETKKED
LPPPPPHGDKTPWQVFMETMNTEFQKSKEWNESTKQIGAAAHQFTESESVRRAREAYERSTGAVSSTASRAVKST
AGAIGKGAAWTWETPVMKGVRKAANVTGEAVDKATKPIRDTEAYKNVKDVIDDGSSSRYGGWVDKEERRKKRALK
EAERAENVQAPPQEDVNAGTNLTLHKDAAWKEAWRDFRDSNRLMQGLFSIKGKYEESENPLISTARSITDRIGGF
FAENETAMVIKKFRSMDPVFQVEPFLQDLREYMLPEVLDAYVKGDTETLRLWLSAAQYSVYEALTKQYLQAGMKS
DGRILDIRNVDILRARMLDPGEVPVFIITCRTQEVHVYRNAKTNELAAGMEDKVQLVTYAIGITRVAEDVNNPET
RGWRMIEMQKSGRDWY*
Coding >Ophun1|6418
ATGCCGTCCTTGGTCCGGAGCGCGCCGAGCACAGCATGTGCGCTTTCGAGAACAACAGCCCGTCCCGCCCACGCC
TACGGCAGGTCTCCCGCCTACCGTAGATTAGCCTCCCAACTCCCCCGTCATCGATCCTCTCTTCAGCCTCTGTCG
CGCACCTTGACACCAGCCCCTCTATCCTTTCGGCAGTTTCACCTCACCGGGAAATTTCAACAAGAGACAAAGCCA
GGGTCGGCCGAGGCGCCAAAACCCACGGAGAAGCCAGTCCCGAAGCCCAAGGGGGAGGAATCTGCGGCGAAAGGC
ACCGACGCTGCAGAGGATGGCAACCAGCAGAAGCCCGCGACAGAGGATCCTGCGGCAAAAGGCACCAAAAATGCA
CAGGATGGCGATCAGCAAAAGACAGAGGGAGAAGAGAACAAGTCAGGAGACAAAGACGAGACTAAAAAAGAAGAT
TTGCCCCCTCCGCCTCCGCACGGAGACAAGACGCCCTGGCAGGTGTTTATGGAGACGATGAACACGGAATTTCAA
AAGTCCAAAGAATGGAATGAGTCTACGAAGCAGATTGGCGCGGCGGCTCATCAGTTCACCGAGAGCGAGTCGGTG
CGCAGGGCGCGCGAAGCCTACGAACGCTCCACTGGTGCCGTGTCCTCGACGGCTTCGCGGGCTGTAAAGTCGACG
GCGGGCGCCATCGGAAAGGGCGCCGCCTGGACTTGGGAGACGCCCGTCATGAAGGGCGTTCGAAAGGCGGCCAAC
GTGACGGGAGAGGCCGTCGACAAGGCTACCAAGCCGATCCGTGACACGGAGGCGTACAAGAACGTCAAGGACGTC
ATCGACGACGGGAGTTCCTCGAGGTACGGCGGCTGGGTGGACAAGGAGGAGCGCCGCAAGAAGAGGGCGCTGAAG
GAGGCCGAGCGCGCTGAAAACGTCCAGGCGCCACCGCAAGAGGATGTAAATGCCGGGACCAACTTGACGTTACAC
AAGGATGCGGCCTGGAAGGAGGCCTGGCGCGACTTTCGCGACTCCAATCGGTTGATGCAGGGCCTTTTCAGCATA
AAGGGCAAATATGAGGAGTCCGAGAACCCGCTCATCTCGACGGCGCGCAGCATCACGGACCGCATCGGCGGCTTC
TTCGCCGAGAATGAGACGGCCATGGTGATCAAGAAGTTCCGCAGCATGGATCCGGTCTTCCAGGTTGAGCCTTTC
CTGCAAGACCTGCGCGAGTACATGCTGCCCGAGGTGCTGGACGCCTATGTCAAGGGCGATACGGAGACACTCAGG
CTGTGGCTCTCGGCCGCGCAATACTCGGTCTACGAGGCGCTGACGAAGCAGTATCTCCAAGCGGGCATGAAGTCG
GATGGGCGCATCCTCGATATACGGAATGTGGACATCTTGCGGGCGCGGATGCTGGACCCGGGCGAGGTGCCCGTC
TTCATCATCACATGCCGCACGCAGGAGGTGCATGTCTACCGCAATGCCAAGACGAACGAGCTGGCGGCGGGCATG
GAAGACAAGGTGCAGCTGGTGACGTATGCCATTGGCATCACGCGTGTGGCCGAGGACGTCAACAACCCGGAGACG
CGAGGATGGCGGATGATTGAGATGCAGAAGAGCGGAAGGGACTGGTACTGA
Transcript >Ophun1|6418
ATGCCGTCCTTGGTCCGGAGCGCGCCGAGCACAGCATGTGCGCTTTCGAGAACAACAGCCCGTCCCGCCCACGCC
TACGGCAGGTCTCCCGCCTACCGTAGATTAGCCTCCCAACTCCCCCGTCATCGATCCTCTCTTCAGCCTCTGTCG
CGCACCTTGACACCAGCCCCTCTATCCTTTCGGCAGTTTCACCTCACCGGGAAATTTCAACAAGAGACAAAGCCA
GGGTCGGCCGAGGCGCCAAAACCCACGGAGAAGCCAGTCCCGAAGCCCAAGGGGGAGGAATCTGCGGCGAAAGGC
ACCGACGCTGCAGAGGATGGCAACCAGCAGAAGCCCGCGACAGAGGATCCTGCGGCAAAAGGCACCAAAAATGCA
CAGGATGGCGATCAGCAAAAGACAGAGGGAGAAGAGAACAAGTCAGGAGACAAAGACGAGACTAAAAAAGAAGAT
TTGCCCCCTCCGCCTCCGCACGGAGACAAGACGCCCTGGCAGGTGTTTATGGAGACGATGAACACGGAATTTCAA
AAGTCCAAAGAATGGAATGAGTCTACGAAGCAGATTGGCGCGGCGGCTCATCAGTTCACCGAGAGCGAGTCGGTG
CGCAGGGCGCGCGAAGCCTACGAACGCTCCACTGGTGCCGTGTCCTCGACGGCTTCGCGGGCTGTAAAGTCGACG
GCGGGCGCCATCGGAAAGGGCGCCGCCTGGACTTGGGAGACGCCCGTCATGAAGGGCGTTCGAAAGGCGGCCAAC
GTGACGGGAGAGGCCGTCGACAAGGCTACCAAGCCGATCCGTGACACGGAGGCGTACAAGAACGTCAAGGACGTC
ATCGACGACGGGAGTTCCTCGAGGTACGGCGGCTGGGTGGACAAGGAGGAGCGCCGCAAGAAGAGGGCGCTGAAG
GAGGCCGAGCGCGCTGAAAACGTCCAGGCGCCACCGCAAGAGGATGTAAATGCCGGGACCAACTTGACGTTACAC
AAGGATGCGGCCTGGAAGGAGGCCTGGCGCGACTTTCGCGACTCCAATCGGTTGATGCAGGGCCTTTTCAGCATA
AAGGGCAAATATGAGGAGTCCGAGAACCCGCTCATCTCGACGGCGCGCAGCATCACGGACCGCATCGGCGGCTTC
TTCGCCGAGAATGAGACGGCCATGGTGATCAAGAAGTTCCGCAGCATGGATCCGGTCTTCCAGGTTGAGCCTTTC
CTGCAAGACCTGCGCGAGTACATGCTGCCCGAGGTGCTGGACGCCTATGTCAAGGGCGATACGGAGACACTCAGG
CTGTGGCTCTCGGCCGCGCAATACTCGGTCTACGAGGCGCTGACGAAGCAGTATCTCCAAGCGGGCATGAAGTCG
GATGGGCGCATCCTCGATATACGGAATGTGGACATCTTGCGGGCGCGGATGCTGGACCCGGGCGAGGTGCCCGTC
TTCATCATCACATGCCGCACGCAGGAGGTGCATGTCTACCGCAATGCCAAGACGAACGAGCTGGCGGCGGGCATG
GAAGACAAGGTGCAGCTGGTGACGTATGCCATTGGCATCACGCGTGTGGCCGAGGACGTCAACAACCCGGAGACG
CGAGGATGGCGGATGATTGAGATGCAGAAGAGCGGAAGGGACTGGTACTGA
Gene >Ophun1|6418
ATGCCGTCCTTGGTCCGGAGCGCGCCGAGCACAGCATGTGCGCTTTCGAGAACAACAGCCCGTCCCGCCCACGCC
TACGGCAGGTCTCCCGCCTACCGTAGATTAGCCTCCCAACTCCCCCGTCATCGATCCTCTCTTCAGCCTCTGTCG
CGCACCTTGACACCAGCCCCTCTATCCTTTCGGCAGTTTCACCTCACCGGGAAATTTCAACAAGAGACAAAGCCA
GGGTCGGCCGAGGCGCCAAAACCCACGGAGAAGCCAGTCCCGAAGCCCAAGGGGGAGGAATCTGCGGCGAAAGGC
ACCGACGCTGCAGAGGATGGCAACCAGCAGAAGCCCGCGACAGAGGATCCTGCGGCAAAAGGCACCAAAAATGCA
CAGGATGGCGATCAGCAAAAGACAGAGGGAGAAGAGAACAAGTCAGGAGACAAAGACGAGACTAAAAAAGAAGAT
TTGCCCCCTCCGCCTCCGCACGGAGACAAGACGCCCTGGCAGGTGTTTATGGAGACGATGAACACGGAATTTCAA
AAGTCCAAAGAATGGAATGAGTCTACGAAGCAGATTGGCGCGGCGGCTCATCAGTTCACCGAGAGCGAGTCGGTG
CGCAGGGCGCGCGAAGCCTACGAACGCTCCACTGGTGCCGTGTCCTCGACGGCTTCGCGGGCTGTAAAGTCGACG
GCGGGCGCCATCGGAAAGGGCGCCGCCTGGACTTGGGAGACGCCCGTCATGAAGGGCGTTCGAAAGGCGGCCAAC
GTGACGGGAGAGGCCGTCGACAAGGCTACCAAGCCGATCCGTGACACGGAGGCGTACAAGAACGTCAAGGACGTC
ATCGACGACGGGAGTTCCTCGAGGTACGGCGGCTGGGTGGACAAGGAGGAGCGCCGCAAGAAGAGGGCGCTGAAG
GAGGCCGAGCGCGCTGAAAACGTCCAGGCGCCACCGCAAGAGGATGTAAAGTGAGATGGCACGGCACCCCTCGTC
GCTAACGTCGCTGATAATCACATCACAACAGTGCCGGGACCAACTTGACGTTACACAAGGATGCGGCCTGGAAGG
AGGCCTGGCGCGACTTTCGCGACTCCAATCGGTTGATGCAGGGCCTTTTCAGCATAAAGGGCAAATATGAGGAGT
CCGAGAACCCGCTCATCTCGACGGCGCGCAGCATCACGGACCGCATCGGCGGCTTCTTCGCCGAGAATGAGACGG
CCATGGTGATCAAGAAGTTCCGCAGCATGGATCCGGTCTTCCAGGTTGAGCCTTTCCTGCAAGACCTGCGCGAGT
ACATGCTGCCCGAGGTGCTGGACGCCTATGTCAAGGGCGATACGGAGACACTCAGGCTGTGGCTCTCGGCCGCGC
AATACTCGGTCTACGAGGCGCTGACGAAGCAGTATCTCCAAGCGGGCATGAAGTCGGATGGGCGCATCCTCGATA
TACGGAATGTGGACATCTTGCGGGCGCGGATGCTGGACCCGGGCGAGGTGCCCGTCTTCATCATCACATGCCGCA
CGCAGGAGGTGCATGTCTACCGCAATGCCAAGACGAACGAGCTGGCGGCGGGCATGGAAGACAAGGTGCAGCTGG
TGACGTATGCCATTGGCATCACGCGTGTGGCCGAGGACGTCAACAACCCGGAGACGCGAGGATGGCGGATGATTG
AGATGCAGAAGAGCGGAAGGGACTGGTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail