Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6410
Gene name
LocationContig_7:25766..29769
Strand+
Gene length (bp)4003
Transcript length (bp)3882
Coding sequence length (bp)3882
Protein length (aa) 1294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain 6.4E-17 388 498
PF13857 Ank_5 Ankyrin repeats (many copies) 6.9E-12 849 904

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C5F1|U507_YARLI UPF0507 protein YALI0E18612g OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E18612g PE=3 SV=1 669 1254 1.0E-67
sp|Q6BJ87|U507_DEBHA UPF0507 protein DEHA2G04334g OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G04334g PE=3 SV=2 673 1039 1.0E-30
sp|Q5A0J0|U507_CANAL UPF0507 protein CaO19.5821/CaO19.13243 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13243 PE=3 SV=1 651 901 4.0E-29
sp|A3LNC4|U507_PICST UPF0507 protein PICST_55861 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_55861 PE=3 SV=2 659 1293 4.0E-28
sp|A5DUP0|U507_LODEL UPF0507 protein LELG_01076 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_01076 PE=3 SV=1 673 894 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C5F1|U507_YARLI UPF0507 protein YALI0E18612g OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E18612g PE=3 SV=1 669 1254 1.0E-67
sp|Q6BJ87|U507_DEBHA UPF0507 protein DEHA2G04334g OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G04334g PE=3 SV=2 673 1039 1.0E-30
sp|Q5A0J0|U507_CANAL UPF0507 protein CaO19.5821/CaO19.13243 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13243 PE=3 SV=1 651 901 4.0E-29
sp|A3LNC4|U507_PICST UPF0507 protein PICST_55861 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_55861 PE=3 SV=2 659 1293 4.0E-28
sp|A5DUP0|U507_LODEL UPF0507 protein LELG_01076 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_01076 PE=3 SV=1 673 894 5.0E-28
sp|P0CF17|U5072_YEAST UPF0507 protein YML002W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML002W PE=3 SV=1 673 913 6.0E-27
sp|A6ZM60|U507_YEAS7 UPF0507 protein SCY_4172 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4172 PE=3 SV=1 673 913 1.0E-26
sp|C8ZEK4|U507_YEAS8 UPF0507 protein EC1118_1M3_1541g OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1M3_1541g PE=3 SV=1 673 913 2.0E-26
sp|B3LLP9|U507_YEAS1 UPF0507 protein SCRG_01893 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_01893 PE=3 SV=1 673 913 3.0E-26
sp|C7GLC0|U507_YEAS2 UPF0507 protein C1Q_01007 OS=Saccharomyces cerevisiae (strain JAY291) GN=C1Q_01007 PE=3 SV=2 673 913 1.0E-25
sp|A5DI74|U507_PICGU UPF0507 protein PGUG_02975 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_02975 PE=3 SV=2 673 901 1.0E-24
sp|Q6CSG8|U507_KLULA UPF0507 protein KLLA0D01133g OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D01133g PE=3 SV=1 654 915 1.0E-23
sp|Q5A0J0|U507_CANAL UPF0507 protein CaO19.5821/CaO19.13243 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13243 PE=3 SV=1 54 531 3.0E-20
sp|Q6BJ87|U507_DEBHA UPF0507 protein DEHA2G04334g OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G04334g PE=3 SV=2 5 526 2.0E-16
sp|Q6C5F1|U507_YARLI UPF0507 protein YALI0E18612g OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E18612g PE=3 SV=1 1 639 2.0E-11
sp|A3LNC4|U507_PICST UPF0507 protein PICST_55861 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_55861 PE=3 SV=2 54 531 4.0E-11
sp|A5DI74|U507_PICGU UPF0507 protein PGUG_02975 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_02975 PE=3 SV=2 321 540 1.0E-08
sp|A5DUP0|U507_LODEL UPF0507 protein LELG_01076 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_01076 PE=3 SV=1 321 536 3.0E-08
sp|P54787|VPS9_YEAST Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS9 PE=1 SV=2 348 498 8.0E-08
sp|Q6CSG8|U507_KLULA UPF0507 protein KLLA0D01133g OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D01133g PE=3 SV=1 439 525 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6410
MQPLNPFLAAFFRSSIVAQCSPVHHYVLLVPLTDLLFTHRETEHGGSVADLVASDDFLTSHVLRIPPPGKDRDAA
TANLRDVRGKPKKYSTLNGRSVLVRDSIVFTNKGFKTLAQAQILSDATWYPDVLEPRQWLLYFVSKPLVGTWEEV
KLSPAVLVHGIKDKEMKALEQSKAQVAESSAESAVPRKKDVRTFHDLLENFPMIARQMQVGLERLFLEFSAVFEK
PLPPPPSASDIPDPKPMGPIEAAAKRARSESLGLRNGDGAPAKLPVMEDFYAEDDEDVMRAALETAVTTAIDLFQ
GVDKQQLSLLGATTDLTGPLVEKLIERYVSENVHHLLFPKLAVIKRPDDLLLEARIRKMEFIDVSQLGIAIDGGP
RAKLDLLIQLGPVADEFKKISAARSPGDMMDTLLATTKAVSRLAPASGVASGGRESAASEKPMLTANADTLVSLL
LFVVIRSQIRNLQARITYVRNFIFIDDIESGEMGYALSTFEAVLAYLLMDSSGLYKASRRNKALWEATKKGDLTE
LRNIMEPSASAIEDRDGDYNDLFGDGEENGSIGGDGSPSPLKPCRRPSLTAWNLVNGSAVTPSLGTVASDRFSHG
SDLSHVFPFQANGDDLPPLPIKRTKRVAMDTRSMSSGSEISFQSRTTSLGTNGSAIEGDISVARLAQTTDALGQS
VLMMAVQHRQTAALGYLLSLSGYYPIDVVLQDMDVERTTLLSAATQLGHAELIDMVLNHVISQASGRQLSRYLSE
QDVRGRSFFHYLFHAPWLIRRIGPMIAWRQRDKNGQTPLFALCRSYDHADYHSMVEAGLAAARDSQGDGQALHVD
DHVDGKGNTLLHIINDAKLAVRILQHGDVDVNATNERRFTALMVASKYGRYDMVRCLFADSRVDVAARELRGLTA
VELAKDDEVRNKIDDLVLFNTPAGRDGRITGVVRAFFVEDGSVRLVLKSAAPTDRDSYTVTTSRRSLAELERMAQ
LLALEHPASWIPTLAEMRSPFQLPTKPSRALLRDIQLRADWFLRIMLRHPTLATHEMLWEFFLVPELQLDAMEQR
TRLKLETRRDKIKDEYEPVEDVGEVEQFASHARDMVRSVGFSTKGVARRVNAVGLAASDLYDSMVLLHRQVSAVH
FMPRSHVDALESYVRAAAPAQSSAQAGLHTTLLAMQSTVQALLSSLSRPGLLIERYWAAQREADRSESSGARSSR
WPLGILDETRQRLLDGREQRVRRLRDEAEEAARELRYTQQTVAAELAGWQEMHESMGRRAVREYAHAMVVQERMR
LSGMMRALRRVRREPRDD*
Coding >Ophun1|6410
ATGCAACCGCTCAATCCCTTCCTGGCCGCCTTCTTCAGAAGCTCCATCGTCGCCCAGTGCTCGCCTGTACACCAC
TATGTCCTCCTCGTGCCGTTGACAGATCTTCTCTTCACACACCGCGAGACAGAACACGGTGGCTCTGTCGCTGAC
CTCGTCGCCTCGGATGACTTCCTGACCAGCCACGTGCTGCGCATTCCGCCCCCGGGCAAGGATAGAGACGCGGCC
ACAGCGAATCTGCGCGATGTAAGGGGCAAGCCGAAGAAGTACTCTACCCTCAACGGCCGGAGCGTTCTAGTAAGG
GACTCCATCGTCTTCACCAACAAAGGCTTCAAGACGCTTGCCCAGGCTCAGATTCTTAGTGACGCTACCTGGTAC
CCCGACGTTTTGGAGCCTCGGCAATGGCTGCTATACTTCGTCTCCAAACCCCTAGTGGGCACCTGGGAGGAGGTC
AAACTGTCGCCGGCCGTCCTTGTCCACGGAATCAAGGACAAGGAGATGAAGGCTCTCGAGCAGAGCAAGGCTCAA
GTCGCGGAGTCTTCGGCAGAGAGCGCAGTCCCGCGCAAAAAGGACGTTCGTACCTTTCACGACTTGTTGGAAAAC
TTCCCCATGATCGCCCGGCAGATGCAGGTCGGCCTCGAAAGGCTGTTCCTTGAGTTCTCCGCCGTCTTTGAGAAA
CCCTTACCTCCTCCGCCCTCGGCCTCTGACATACCGGATCCGAAGCCTATGGGCCCCATCGAGGCCGCGGCCAAG
AGGGCACGCTCTGAAAGTCTCGGACTGAGGAACGGCGACGGGGCTCCCGCCAAGCTGCCCGTTATGGAGGACTTT
TACGCCGAAGACGACGAAGACGTCATGAGGGCCGCGCTCGAGACTGCCGTCACAACCGCCATCGACCTCTTTCAG
GGCGTCGACAAACAACAGCTGTCTCTCCTCGGTGCCACGACCGACCTGACTGGCCCGCTCGTCGAGAAGCTCATT
GAGCGCTACGTCTCCGAGAATGTTCACCATCTGCTCTTTCCCAAGCTCGCCGTTATCAAGCGACCCGACGATCTG
CTGCTGGAAGCCAGGATCAGAAAAATGGAGTTTATTGACGTGTCGCAACTGGGCATTGCCATTGACGGCGGCCCG
AGGGCCAAACTCGATCTGCTCATTCAACTAGGACCCGTCGCCGACGAGTTCAAGAAAATCTCGGCCGCCCGGAGC
CCTGGGGACATGATGGACACCCTACTGGCGACCACGAAGGCTGTCTCCCGCTTGGCTCCAGCATCTGGTGTGGCG
AGTGGCGGCCGAGAGTCGGCAGCGTCAGAAAAGCCCATGTTGACTGCCAATGCCGACACGCTCGTTTCCCTCCTA
CTCTTTGTCGTCATCCGTTCACAAATTCGCAATCTGCAGGCACGAATCACCTACGTTCGCAACTTTATCTTTATT
GACGACATCGAGAGCGGAGAGATGGGTTACGCCTTGAGTACCTTTGAGGCCGTGCTGGCATACTTGCTTATGGAC
TCGTCGGGCTTGTACAAGGCCAGCAGGAGGAACAAGGCCTTATGGGAGGCGACAAAGAAGGGTGATCTGACAGAA
TTGAGAAACATTATGGAGCCGAGCGCGTCGGCCATTGAAGACCGCGATGGAGACTACAATGATCTGTTCGGCGAT
GGCGAGGAAAATGGATCAATCGGAGGCGACGGATCGCCTAGTCCCTTGAAGCCCTGCCGGCGCCCCTCATTGACG
GCTTGGAACCTCGTCAATGGATCGGCCGTAACGCCATCGCTGGGTACCGTCGCCTCGGACCGGTTCTCGCACGGC
TCCGACCTCAGCCACGTCTTCCCCTTCCAGGCGAATGGCGACGACCTGCCGCCGCTTCCCATCAAGAGGACCAAG
AGGGTGGCCATGGACACCAGAAGCATGTCGAGCGGGTCGGAAATATCGTTCCAGTCCCGTACGACGAGCCTGGGG
ACCAACGGTAGCGCCATTGAGGGCGACATATCGGTGGCGAGGCTGGCCCAGACGACTGACGCTTTGGGCCAGTCG
GTGCTGATGATGGCGGTACAACACAGGCAGACGGCCGCCTTGGGGTATCTGCTGAGTCTCTCGGGCTACTACCCG
ATTGACGTGGTGCTGCAGGACATGGACGTCGAGCGCACGACGCTCTTGAGCGCCGCGACGCAACTGGGTCACGCG
GAGCTGATTGACATGGTCCTAAACCACGTCATATCCCAAGCGTCGGGGCGGCAGCTCTCGCGATACCTGTCGGAA
CAGGACGTCCGGGGCCGCAGTTTCTTTCACTACCTGTTTCACGCGCCCTGGCTCATCCGACGGATCGGCCCCATG
ATAGCGTGGCGGCAGCGGGACAAGAACGGGCAGACGCCGCTGTTTGCGCTGTGTCGGTCCTACGATCACGCGGAT
TATCACAGCATGGTCGAGGCCGGGCTGGCGGCGGCGCGAGACTCGCAGGGCGACGGGCAGGCGCTGCACGTGGAC
GACCATGTTGACGGCAAGGGAAACACGCTTCTGCACATCATCAACGACGCGAAGCTGGCGGTGCGGATCCTGCAG
CACGGCGACGTCGACGTCAACGCGACCAACGAAAGGCGCTTCACGGCGCTCATGGTGGCCAGCAAGTACGGGCGG
TACGACATGGTGCGGTGCCTCTTCGCCGATTCGCGCGTCGACGTGGCGGCGCGGGAGCTGCGCGGGCTGACGGCG
GTCGAGCTGGCCAAGGATGACGAGGTGCGCAACAAGATCGACGACTTGGTCCTGTTCAACACGCCGGCCGGACGC
GACGGGCGTATCACGGGTGTGGTGCGGGCCTTTTTCGTCGAGGACGGAAGCGTGCGGCTGGTGCTCAAGTCGGCA
GCTCCGACGGACCGCGACAGCTACACGGTGACGACGAGCCGGCGATCGCTGGCGGAGCTGGAGCGGATGGCGCAG
CTGCTGGCGCTCGAGCACCCGGCCTCGTGGATCCCGACGCTGGCCGAGATGCGGTCCCCGTTTCAACTGCCGACG
AAGCCGTCGCGGGCGCTGCTGCGCGACATACAGCTCCGCGCCGACTGGTTCCTGCGCATCATGCTGAGACACCCG
ACGCTGGCGACGCACGAGATGCTGTGGGAGTTTTTCCTGGTGCCGGAGCTGCAGCTCGACGCCATGGAGCAGCGG
ACGCGTCTCAAGCTGGAGACGAGGCGCGACAAGATCAAGGACGAGTACGAGCCGGTGGAAGACGTGGGCGAGGTG
GAGCAATTCGCCAGCCATGCGAGGGACATGGTCAGAAGCGTCGGCTTCTCGACCAAGGGGGTTGCCAGGAGGGTG
AATGCCGTGGGACTGGCGGCCTCGGATCTGTACGACTCCATGGTGTTGCTGCACAGGCAGGTGTCGGCGGTGCAC
TTCATGCCGCGCTCGCACGTGGACGCGCTCGAGTCCTACGTCAGGGCCGCGGCGCCGGCGCAGTCGAGCGCACAA
GCGGGGCTGCACACGACGTTGCTGGCGATGCAGTCGACGGTGCAGGCACTGTTGTCGTCCCTGTCGCGGCCCGGG
CTGCTGATCGAGCGATACTGGGCGGCGCAGAGGGAGGCGGACCGCAGCGAGAGTTCGGGGGCGCGGTCGTCGCGT
TGGCCGCTGGGGATCCTCGACGAGACGCGACAGAGGCTCCTGGATGGGCGGGAACAGCGAGTGCGGCGGCTGCGG
GATGAGGCCGAGGAGGCGGCGCGCGAGCTGCGGTACACGCAGCAGACGGTGGCGGCCGAGCTGGCCGGGTGGCAG
GAGATGCACGAGAGCATGGGCAGGCGGGCGGTGCGCGAGTACGCGCATGCCATGGTGGTGCAGGAGCGGATGAGG
CTGAGCGGGATGATGCGCGCCCTGAGGAGGGTGAGGCGCGAGCCGCGCGACGACTGA
Transcript >Ophun1|6410
ATGCAACCGCTCAATCCCTTCCTGGCCGCCTTCTTCAGAAGCTCCATCGTCGCCCAGTGCTCGCCTGTACACCAC
TATGTCCTCCTCGTGCCGTTGACAGATCTTCTCTTCACACACCGCGAGACAGAACACGGTGGCTCTGTCGCTGAC
CTCGTCGCCTCGGATGACTTCCTGACCAGCCACGTGCTGCGCATTCCGCCCCCGGGCAAGGATAGAGACGCGGCC
ACAGCGAATCTGCGCGATGTAAGGGGCAAGCCGAAGAAGTACTCTACCCTCAACGGCCGGAGCGTTCTAGTAAGG
GACTCCATCGTCTTCACCAACAAAGGCTTCAAGACGCTTGCCCAGGCTCAGATTCTTAGTGACGCTACCTGGTAC
CCCGACGTTTTGGAGCCTCGGCAATGGCTGCTATACTTCGTCTCCAAACCCCTAGTGGGCACCTGGGAGGAGGTC
AAACTGTCGCCGGCCGTCCTTGTCCACGGAATCAAGGACAAGGAGATGAAGGCTCTCGAGCAGAGCAAGGCTCAA
GTCGCGGAGTCTTCGGCAGAGAGCGCAGTCCCGCGCAAAAAGGACGTTCGTACCTTTCACGACTTGTTGGAAAAC
TTCCCCATGATCGCCCGGCAGATGCAGGTCGGCCTCGAAAGGCTGTTCCTTGAGTTCTCCGCCGTCTTTGAGAAA
CCCTTACCTCCTCCGCCCTCGGCCTCTGACATACCGGATCCGAAGCCTATGGGCCCCATCGAGGCCGCGGCCAAG
AGGGCACGCTCTGAAAGTCTCGGACTGAGGAACGGCGACGGGGCTCCCGCCAAGCTGCCCGTTATGGAGGACTTT
TACGCCGAAGACGACGAAGACGTCATGAGGGCCGCGCTCGAGACTGCCGTCACAACCGCCATCGACCTCTTTCAG
GGCGTCGACAAACAACAGCTGTCTCTCCTCGGTGCCACGACCGACCTGACTGGCCCGCTCGTCGAGAAGCTCATT
GAGCGCTACGTCTCCGAGAATGTTCACCATCTGCTCTTTCCCAAGCTCGCCGTTATCAAGCGACCCGACGATCTG
CTGCTGGAAGCCAGGATCAGAAAAATGGAGTTTATTGACGTGTCGCAACTGGGCATTGCCATTGACGGCGGCCCG
AGGGCCAAACTCGATCTGCTCATTCAACTAGGACCCGTCGCCGACGAGTTCAAGAAAATCTCGGCCGCCCGGAGC
CCTGGGGACATGATGGACACCCTACTGGCGACCACGAAGGCTGTCTCCCGCTTGGCTCCAGCATCTGGTGTGGCG
AGTGGCGGCCGAGAGTCGGCAGCGTCAGAAAAGCCCATGTTGACTGCCAATGCCGACACGCTCGTTTCCCTCCTA
CTCTTTGTCGTCATCCGTTCACAAATTCGCAATCTGCAGGCACGAATCACCTACGTTCGCAACTTTATCTTTATT
GACGACATCGAGAGCGGAGAGATGGGTTACGCCTTGAGTACCTTTGAGGCCGTGCTGGCATACTTGCTTATGGAC
TCGTCGGGCTTGTACAAGGCCAGCAGGAGGAACAAGGCCTTATGGGAGGCGACAAAGAAGGGTGATCTGACAGAA
TTGAGAAACATTATGGAGCCGAGCGCGTCGGCCATTGAAGACCGCGATGGAGACTACAATGATCTGTTCGGCGAT
GGCGAGGAAAATGGATCAATCGGAGGCGACGGATCGCCTAGTCCCTTGAAGCCCTGCCGGCGCCCCTCATTGACG
GCTTGGAACCTCGTCAATGGATCGGCCGTAACGCCATCGCTGGGTACCGTCGCCTCGGACCGGTTCTCGCACGGC
TCCGACCTCAGCCACGTCTTCCCCTTCCAGGCGAATGGCGACGACCTGCCGCCGCTTCCCATCAAGAGGACCAAG
AGGGTGGCCATGGACACCAGAAGCATGTCGAGCGGGTCGGAAATATCGTTCCAGTCCCGTACGACGAGCCTGGGG
ACCAACGGTAGCGCCATTGAGGGCGACATATCGGTGGCGAGGCTGGCCCAGACGACTGACGCTTTGGGCCAGTCG
GTGCTGATGATGGCGGTACAACACAGGCAGACGGCCGCCTTGGGGTATCTGCTGAGTCTCTCGGGCTACTACCCG
ATTGACGTGGTGCTGCAGGACATGGACGTCGAGCGCACGACGCTCTTGAGCGCCGCGACGCAACTGGGTCACGCG
GAGCTGATTGACATGGTCCTAAACCACGTCATATCCCAAGCGTCGGGGCGGCAGCTCTCGCGATACCTGTCGGAA
CAGGACGTCCGGGGCCGCAGTTTCTTTCACTACCTGTTTCACGCGCCCTGGCTCATCCGACGGATCGGCCCCATG
ATAGCGTGGCGGCAGCGGGACAAGAACGGGCAGACGCCGCTGTTTGCGCTGTGTCGGTCCTACGATCACGCGGAT
TATCACAGCATGGTCGAGGCCGGGCTGGCGGCGGCGCGAGACTCGCAGGGCGACGGGCAGGCGCTGCACGTGGAC
GACCATGTTGACGGCAAGGGAAACACGCTTCTGCACATCATCAACGACGCGAAGCTGGCGGTGCGGATCCTGCAG
CACGGCGACGTCGACGTCAACGCGACCAACGAAAGGCGCTTCACGGCGCTCATGGTGGCCAGCAAGTACGGGCGG
TACGACATGGTGCGGTGCCTCTTCGCCGATTCGCGCGTCGACGTGGCGGCGCGGGAGCTGCGCGGGCTGACGGCG
GTCGAGCTGGCCAAGGATGACGAGGTGCGCAACAAGATCGACGACTTGGTCCTGTTCAACACGCCGGCCGGACGC
GACGGGCGTATCACGGGTGTGGTGCGGGCCTTTTTCGTCGAGGACGGAAGCGTGCGGCTGGTGCTCAAGTCGGCA
GCTCCGACGGACCGCGACAGCTACACGGTGACGACGAGCCGGCGATCGCTGGCGGAGCTGGAGCGGATGGCGCAG
CTGCTGGCGCTCGAGCACCCGGCCTCGTGGATCCCGACGCTGGCCGAGATGCGGTCCCCGTTTCAACTGCCGACG
AAGCCGTCGCGGGCGCTGCTGCGCGACATACAGCTCCGCGCCGACTGGTTCCTGCGCATCATGCTGAGACACCCG
ACGCTGGCGACGCACGAGATGCTGTGGGAGTTTTTCCTGGTGCCGGAGCTGCAGCTCGACGCCATGGAGCAGCGG
ACGCGTCTCAAGCTGGAGACGAGGCGCGACAAGATCAAGGACGAGTACGAGCCGGTGGAAGACGTGGGCGAGGTG
GAGCAATTCGCCAGCCATGCGAGGGACATGGTCAGAAGCGTCGGCTTCTCGACCAAGGGGGTTGCCAGGAGGGTG
AATGCCGTGGGACTGGCGGCCTCGGATCTGTACGACTCCATGGTGTTGCTGCACAGGCAGGTGTCGGCGGTGCAC
TTCATGCCGCGCTCGCACGTGGACGCGCTCGAGTCCTACGTCAGGGCCGCGGCGCCGGCGCAGTCGAGCGCACAA
GCGGGGCTGCACACGACGTTGCTGGCGATGCAGTCGACGGTGCAGGCACTGTTGTCGTCCCTGTCGCGGCCCGGG
CTGCTGATCGAGCGATACTGGGCGGCGCAGAGGGAGGCGGACCGCAGCGAGAGTTCGGGGGCGCGGTCGTCGCGT
TGGCCGCTGGGGATCCTCGACGAGACGCGACAGAGGCTCCTGGATGGGCGGGAACAGCGAGTGCGGCGGCTGCGG
GATGAGGCCGAGGAGGCGGCGCGCGAGCTGCGGTACACGCAGCAGACGGTGGCGGCCGAGCTGGCCGGGTGGCAG
GAGATGCACGAGAGCATGGGCAGGCGGGCGGTGCGCGAGTACGCGCATGCCATGGTGGTGCAGGAGCGGATGAGG
CTGAGCGGGATGATGCGCGCCCTGAGGAGGGTGAGGCGCGAGCCGCGCGACGACTGA
Gene >Ophun1|6410
ATGCAACCGCTCAATCCCTTCCTGGCCGCCTTCTTCAGAAGCTCCATCGTCGCCCAGTGCTCGCCTGTACACCAC
TATGTCCTCCTCGTGCCGTTGACAGATCTTCTCTTCACACACCGCGAGACAGAACACGGTGGCTCTGTCGCTGAC
CTCGTCGCCTCGGATGACTTCCTGACCAGCCACGTGCTGCGCATTCCGCCCCCGGGCAAGGATAGAGACGCGGCC
ACAGCGAATCTGCGCGATGTAAGGGGCAAGCCGAAGAAGTACTCTACCCTCAACGGCCGGAGCGTTCTAGTAAGG
GACTCCATCGTCTTCACCAACAAAGGTGCAGTCTCGTTACCCCTCCCCACCCTAGCTGCGGCCACATCGCTGACA
AGCCATCCAATCCGCAGGCTTCAAGACGCTTGCCCAGGCTCAGATTCTTAGTGACGCTACCTGGTACCCCGACGT
TTTGGAGCCTCGGCAATGGCTGCTATACTTCGTCTCCAAACCCCTAGTGGGCACCTGGGAGGAGGTCAAACTGTC
GCCGGCCGTCCTTGTCCACGGAATCAAGGACAAGGAGATGAAGGCTCTCGAGCAGAGCAAGGCTCAAGTCGCGGA
GTCTTCGGCAGAGAGCGCAGTCCCGCGCAAAAAGGACGTTCGTACCTTTCACGACTTGTTGGAAAACTTCCCCAT
GATCGCCCGGCAGATGCAGGTCGGCCTCGAAAGGCTGTTCCTTGAGTTCTCCGCCGTCTTTGAGAAACCCTTACC
TCCTCCGCCCTCGGCCTCTGACATACCGGATCCGAAGCCTATGGGCCCCATCGAGGCCGCGGCCAAGAGGGCACG
CTCTGAAAGTCTCGGACTGAGGAACGGCGACGGGGCTCCCGCCAAGCTGCCCGTTATGGAGGACTTTTACGCCGA
AGACGACGAAGACGTCATGAGGGCCGCGCTCGAGACTGCCGTCACAACCGCCATCGACCTCTTTCAGGGCGTCGA
CAAACAACAGCTGTCTCTCCTCGGTGCCACGACCGACCTGACTGGCCCGCTCGTCGAGAAGCTCATTGAGCGCTA
CGTCTCCGAGAATGTTCACCATCTGCTCTTTCCCAAGCTCGCCGTTATCAAGCGACCCGACGATCTGCTGCTGGA
AGCCAGGATCAGAAAAATGGAGTTTATTGACGTGTCGCAACTGGGCATTGCCATTGACGGCGGCCCGAGGGCCAA
ACTCGATCTGCTCATTCAACTAGGACCCGTCGCCGACGAGTTCAAGAAAATCTCGGCCGCCCGGAGCCCTGGGGA
CATGATGGACACCCTACTGGCGACCACGAAGGCTGTCTCCCGCTTGGCTCCAGCATCTGGTGTGGCGAGTGGCGG
CCGAGAGTCGGCAGCGTCAGAAAAGCCCATGTTGACTGCCAATGCCGACACGCTCGTTTCCCTCCTACTCTTTGT
CGTCATCCGTTCACAAATTCGCAATCTGCAGGCACGAATCACCTACGTTCGCAACTTTATCTTTATTGACGACAT
CGAGAGCGGAGAGATGGGTTACGCCTTGAGTACCTTTGAGGCCGTGCTGGCATACTTGCTTATGGACTCGTCGGG
CTTGTACAAGGCCAGCAGGAGGAACAAGGCCTTATGGGAGGCGACAAAGAAGGGTGATCTGACAGAATTGAGAAA
CATTATGGAGCCGAGCGCGTCGGCCATTGAAGACCGCGATGGAGACTACAATGATCTGTTCGGCGATGGCGAGGA
AAATGGATCAATCGGAGGCGACGGATCGCCTAGTCCCTTGAAGCCCTGCCGGCGCCCCTCATTGACGGCTTGGAA
CCTCGTCAATGGATCGGCCGTAACGCCATCGCTGGGTACCGTCGCCTCGGACCGGTTCTCGCACGGCTCCGACCT
CAGCCACGTCTTCCCCTTCCAGGCGAATGGCGACGACCTGCCGCCGCTTCCCATCAAGAGGACCAAGAGGGTGGC
CATGGACACCAGAAGCATGTCGAGCGGGTCGGAAATATCGTTCCAGTCCCGTACGACGAGCCTGGGGACCAACGG
TAGCGCCATTGAGGGCGACATATCGGTGGCGAGGCTGGCCCAGACGACTGACGCTTTGGGCCAGTCGGTGCTGAT
GATGGCGGTACAACACAGGCAGACGGCCGCCTTGGGGTATCTGCTGAGTCTCTCGGGCTACTACCCGATTGACGT
GGTGCTGCAGGACATGGACGTCGAGCGCACGACGCTCTTGAGCGCCGCGACGCAACTGGGTCACGCGGAGCTGAT
TGACATGGTCCTAAACCACGTCATATCCCAAGCGTCGGGGCGGCAGCTCTCGCGATACCTGTCGGAACAGGACGT
CCGGGGCCGCAGTTTCTTTCACTACCTGTTTCACGCGCCCTGGCTCATCCGACGGATCGGCCCCATGATAGCGTG
GCGGCAGCGGGACAAGAACGGGCAGACGCCGCTGTTTGCGCTGTGTCGGTCCTACGATCACGCGGATTATCACAG
CATGGTCGAGGCCGGGCTGGCGGCGGCGCGAGACTCGCAGGGCGACGGGCAGGCGCTGCACGTGGACGACCATGT
TGACGGCAAGGGAAACACGCTTCTGCACATCATCAACGACGCGAAGCTGGCGGTGCGGATCCTGCAGCACGGCGA
CGTCGACGTCAACGCGACCAACGAAAGGCGCTTCACGGCGCTCATGGTGGCCAGCAAGTACGGGCGGTACGACAT
GGTGCGGTGCCTCTTCGCCGATTCGCGCGTCGACGTGGCGGCGCGGGAGCTGCGCGGGCTGACGGCGGTCGAGCT
GGCCAAGGATGACGAGGTGCGCAACAAGATCGACGACTTGGTCCTGTTCAACACGCCGGCCGGACGCGACGGGCG
TATCACGGGTGTGGTGCGGGCCTTTTTCGTCGAGGACGGAAGCGTGCGGCTGGTGCTCAAGTCGGCAGCTCCGAC
GGACCGCGACAGCTACACGGTGACGACGAGCCGGCGATCGCTGGCGGAGCTGGAGCGGATGGCGCAGCTGCTGGC
GCTCGAGCACCCGGCCTCGTGGATCCCGACGCTGGCCGAGATGCGGTCCCCGTTTCAACTGCCGACGAAGCCGTC
GCGGGCGCTGCTGCGCGACATACAGCTCCGCGCCGACTGGTTCCTGCGCATCATGCTGAGACACCCGACGCTGGC
GACGCACGAGATGCTGTGGGAGTTTTTCCTGGTGCCGGAGCTGCAGCTCGACGCCATGGAGCAGCGGACGCGTCT
CAAGCTGGAGACGAGGCGCGACAAGATCAAGGACGAGTACGAGCCGGTGGAAGACGTGGGCGAGGTGGAGCAATT
CGCCAGCCATGCGAGGGACATGGTCAGAAGCGTCGGCTTCTCGACCAAGGGGGTTGCCAGGAGGGTGAATGCCGT
GGGACTGGCGGCCTCGGGTGAGCCACTCATCCATGCTCTCGGTCAGCCAGTAAACTGACGTCGGTTCCTAGATCT
GTACGACTCCATGGTGTTGCTGCACAGGCAGGTGTCGGCGGTGCACTTCATGCCGCGCTCGCACGTGGACGCGCT
CGAGTCCTACGTCAGGGCCGCGGCGCCGGCGCAGTCGAGCGCACAAGCGGGGCTGCACACGACGTTGCTGGCGAT
GCAGTCGACGGTGCAGGCACTGTTGTCGTCCCTGTCGCGGCCCGGGCTGCTGATCGAGCGATACTGGGCGGCGCA
GAGGGAGGCGGACCGCAGCGAGAGTTCGGGGGCGCGGTCGTCGCGTTGGCCGCTGGGGATCCTCGACGAGACGCG
ACAGAGGCTCCTGGATGGGCGGGAACAGCGAGTGCGGCGGCTGCGGGATGAGGCCGAGGAGGCGGCGCGCGAGCT
GCGGTACACGCAGCAGACGGTGGCGGCCGAGCTGGCCGGGTGGCAGGAGATGCACGAGAGCATGGGCAGGCGGGC
GGTGCGCGAGTACGCGCATGCCATGGTGGTGCAGGAGCGGATGAGGCTGAGCGGGATGATGCGCGCCCTGAGGAG
GGTGAGGCGCGAGCCGCGCGACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail