Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6406
Gene name
LocationContig_7:14261..18306
Strand-
Gene length (bp)4045
Transcript length (bp)3438
Coding sequence length (bp)3438
Protein length (aa) 1146

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12569 NatA_aux_su N-terminal acetyltransferase A, auxiliary subunit 1.7E-180 503 1010
PF09774 MIX23 Intermembrane space protein MIX23 1.2E-47 74 225
PF13432 TPR_16 Tetratricopeptide repeat 3.1E-03 403 441
PF13432 TPR_16 Tetratricopeptide repeat 5.6E-05 518 571
PF13414 TPR_11 TPR repeat 3.0E-06 403 442

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74985|NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat1 PE=1 SV=1 324 1020 1.0E-148
sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 320 1135 5.0E-147
sp|Q5R4J9|NAA15_PONAB N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Pongo abelii GN=NAA15 PE=2 SV=1 320 1135 5.0E-147
sp|Q80UM3|NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus GN=Naa15 PE=1 SV=1 320 1136 2.0E-146
sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 320 1116 5.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74985|NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat1 PE=1 SV=1 324 1020 1.0E-148
sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 320 1135 5.0E-147
sp|Q5R4J9|NAA15_PONAB N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Pongo abelii GN=NAA15 PE=2 SV=1 320 1135 5.0E-147
sp|Q80UM3|NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus GN=Naa15 PE=1 SV=1 320 1136 2.0E-146
sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 320 1116 5.0E-146
sp|Q9DBB4|NAA16_MOUSE N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Mus musculus GN=Naa16 PE=2 SV=1 320 1116 3.0E-143
sp|P12945|NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT1 PE=1 SV=2 327 966 5.0E-88
sp|Q9Y7X2|YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC418.02 PE=3 SV=1 324 976 3.0E-48
sp|O06917|Y263_METJA TPR repeat-containing protein MJ0263 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0263 PE=3 SV=1 332 537 1.0E-09
sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1345 PE=3 SV=1 338 577 2.0E-06
sp|O74982|CID2_SCHPO Caffeine-induced death protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid2 PE=2 SV=1 74 236 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005758 mitochondrial intermembrane space Yes
GO:0070013 intracellular organelle lumen No
GO:0043233 organelle lumen No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0031970 organelle envelope lumen No
GO:0031974 membrane-enclosed lumen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6406
MSSPQPSAAKTTGAAKSGWFFAQHSSPYPQNMSQLPQRPQLTPQFCFSTGTLRGKPNFYSANLHLCEARSCEPLI
DFLRLSRSSVDDTVSQNLNALVTPSKKGFDPDSTSRRSTPPTLRTLGRPACQSYYENVLFPAWQARTEVLDYCAL
VATSPDPNDPEAALREAENQQDRQRVVDERLDPYSARFFPREARTQTLASIIRQERDVEKIVRTQSWNVIQQRCA
ALREDYDDAVRRWRDGQPSSRSIPKTKHLRLAKSPTQRVRRRASSALERSVDSYDLRRWASDRDPERTPEDSGLR
RTGSPDIRSASQSPPSLPTMPQALGPKEAANFRAVIRSYEDKQYKRGLKTADLILKKHPKHGDTMAMKALILNSQ
GKTDEAFALAKEALKVDMKSHICWHVYGLLYRANKNFEEAIKAYKFALKLEPESPQIQRDLAILQVQMRDYAGYI
QSRTAMLQARPQLRQSWTALAIAHHLSGNLAEAENVLTTYEGTLKATPPRHDIEHSEAVMYKNSLMAEQGDYQRA
LDHLNRAAKHNLDRLAVMEARADYLARLGREDEAAKAYRALLDRNSEHPIYYEKLIAALGISLDNLTARKAVYDE
YVRKAPRGDAARRMPLDFLRGKQSRPPLPPLPAAREYLKLMLDKGVPSTFANLKHLYSDSEKKKILRELAEEYLE
SQTTDSSSKDKGEAAALFYLAQHYNYHLSRDLDKAAEYTERAIGKDAKSVDFHMTKARILKHRGYLQKASEAMDY
ARTLDLKDRYINSKAAKYQLRNNENERALKTVGLFTRADTAGGPLADLLDMQCVWYLTEDGEAHARQGNVGLALK
RFLAVTNIFDVWQEDQFDFHSFSLRKGQVRAYIDMMRWEDHVRDHPFYSRAALNGIGVYLGMADKAAAAANGVNG
VEAAGGEDALAAKKAAKKARKEQQRLEREATEKLAKQDPNKGGGGEAKKTDDDPLGLKLAATTDPLGEAMKLLVP
LLQACPKSIEAQLAGFDVYMQRNKYVLALRCLKAAVALDADFPGVPERVVSFYAILETTKDLSGKARDALRVEFK
TVDEVGGAREYVEAFRRRHPKSPRHALSAVAAKRLLPGLDRASCDKEAAALVDMEGSTSDDAVRLLDTLRGWRSG
EAMRLKKAAQAKWPEVTRLA*
Coding >Ophun1|6406
ATGTCTTCCCCGCAGCCGTCGGCCGCAAAGACGACTGGAGCCGCAAAGAGCGGCTGGTTTTTCGCTCAGCATAGC
TCGCCGTATCCGCAGAACATGAGCCAGCTCCCGCAACGGCCACAACTAACACCGCAGTTCTGCTTTTCCACTGGG
ACGCTGCGTGGTAAGCCCAATTTCTACTCTGCCAATTTACACCTTTGCGAAGCCCGCTCATGCGAGCCGTTGATA
GACTTTTTGCGACTTTCCAGGTCTTCTGTTGACGACACCGTCTCCCAAAACCTCAATGCGCTCGTGACGCCCTCA
AAAAAGGGCTTCGATCCTGACTCGACGTCTCGGCGGTCGACGCCACCGACTTTACGAACCCTTGGTCGGCCCGCT
TGTCAGTCGTATTACGAAAACGTGCTCTTCCCTGCGTGGCAGGCGAGGACCGAGGTGCTCGACTACTGCGCTTTG
GTCGCCACCAGCCCCGATCCTAACGATCCGGAGGCTGCGCTTCGAGAGGCTGAAAACCAACAGGACCGTCAACGG
GTCGTGGACGAACGCCTGGATCCATACTCGGCCAGGTTTTTCCCGCGGGAGGCACGCACCCAGACACTAGCCAGC
ATTATCCGCCAGGAACGCGACGTTGAGAAAATCGTAAGGACTCAGTCCTGGAACGTTATCCAGCAGCGGTGCGCG
GCGCTGCGTGAGGACTATGACGACGCCGTCAGGAGATGGAGAGACGGGCAACCGTCTTCCCGATCAATCCCAAAG
ACGAAGCACCTACGCCTCGCCAAGTCGCCCACACAACGAGTCCGACGCCGTGCCTCGTCTGCGCTCGAAAGGTCG
GTAGACAGCTACGACCTGCGTCGCTGGGCCTCCGATAGGGACCCCGAACGGACTCCCGAAGATTCGGGCCTCCGA
AGAACCGGGTCCCCCGATATCCGATCAGCCTCACAGTCGCCCCCATCCCTACCCACGATGCCGCAGGCGCTGGGA
CCCAAGGAGGCGGCCAACTTTCGAGCCGTCATCCGAAGCTACGAGGACAAGCAGTACAAACGCGGCCTTAAGACT
GCCGACCTCATCCTAAAAAAACATCCCAAGCATGGCGACACAATGGCCATGAAGGCCCTGATTCTCAACAGCCAG
GGCAAGACGGACGAGGCTTTTGCACTAGCAAAGGAGGCCCTCAAGGTCGACATGAAGTCGCACATCTGCTGGCAC
GTCTATGGCCTGCTTTACCGCGCCAACAAAAACTTCGAGGAGGCCATCAAGGCCTACAAATTTGCACTCAAGCTC
GAGCCCGAGTCGCCGCAGATCCAGAGAGATCTCGCCATTCTTCAAGTCCAGATGCGTGATTACGCCGGATACATA
CAGAGTAGAACCGCTATGCTGCAGGCGCGGCCGCAGCTGCGTCAGAGCTGGACCGCCCTCGCCATCGCCCACCAT
CTGTCCGGTAACCTCGCTGAAGCGGAAAACGTACTCACGACGTACGAGGGCACGCTCAAGGCCACACCGCCGCGC
CACGATATCGAACACTCCGAGGCCGTCATGTACAAGAACTCGTTGATGGCCGAGCAGGGCGACTACCAACGGGCC
TTGGATCACCTCAACCGCGCCGCCAAGCACAATCTCGACCGGCTTGCCGTCATGGAGGCTCGAGCCGACTACCTC
GCCCGGCTGGGTCGAGAAGACGAGGCCGCAAAGGCGTACCGCGCTCTGCTTGACCGTAACTCGGAGCATCCGATT
TACTACGAGAAGCTGATAGCCGCGCTCGGCATCTCCCTCGACAACCTGACAGCACGCAAGGCCGTCTACGACGAA
TATGTGCGCAAGGCGCCGCGCGGGGACGCTGCCAGACGAATGCCCCTTGACTTTCTGCGAGGCAAGCAATCACGC
CCCCCCCTTCCTCCCCTGCCCGCGGCCAGGGAGTATCTGAAGCTCATGCTGGATAAGGGCGTGCCGTCGACGTTT
GCCAACCTCAAGCATCTCTATTCGGATTCGGAGAAGAAGAAGATATTGAGGGAGCTGGCAGAGGAATACCTCGAG
TCGCAAACGACAGACTCGTCGAGTAAGGACAAGGGCGAGGCGGCCGCGCTATTCTATCTCGCACAACACTACAAC
TACCACCTCAGCCGAGACTTGGATAAGGCGGCCGAGTACACGGAGCGAGCCATCGGAAAAGACGCCAAGAGCGTG
GATTTCCACATGACGAAAGCCAGGATACTGAAGCACCGTGGATATCTCCAGAAGGCCTCGGAGGCAATGGATTAT
GCACGGACGCTGGATCTTAAAGACCGATACATCAACAGCAAGGCGGCCAAGTACCAGCTGAGGAACAACGAGAAT
GAGCGCGCCCTCAAGACAGTCGGTCTGTTTACGCGAGCCGACACGGCGGGCGGCCCGCTGGCGGACCTGCTGGAC
ATGCAGTGCGTCTGGTACTTGACGGAGGACGGCGAGGCGCACGCGCGACAGGGCAACGTCGGGCTGGCGCTGAAG
CGATTCCTGGCCGTCACCAACATCTTTGACGTGTGGCAGGAAGACCAGTTCGACTTTCACAGCTTCTCGCTCCGC
AAGGGCCAGGTGCGAGCCTACATCGACATGATGCGATGGGAGGACCACGTGCGCGACCACCCGTTCTACTCGCGG
GCGGCGCTCAACGGGATCGGCGTCTACCTCGGTATGGCCGATAAGGCGGCGGCGGCGGCCAACGGCGTCAATGGG
GTCGAGGCAGCGGGCGGTGAGGACGCGCTGGCGGCGAAGAAGGCTGCAAAGAAGGCGCGCAAAGAGCAGCAGCGC
CTGGAACGAGAAGCGACCGAGAAACTGGCAAAACAGGACCCTAACAAGGGTGGCGGGGGCGAGGCTAAGAAGACG
GACGACGACCCGCTGGGCCTGAAGCTGGCGGCGACGACGGATCCGCTGGGCGAGGCCATGAAGCTGCTGGTGCCG
CTACTTCAGGCGTGTCCGAAGAGCATCGAGGCGCAGCTGGCGGGTTTCGACGTGTACATGCAGCGCAACAAGTAC
GTGCTGGCGCTACGGTGCCTCAAGGCGGCCGTCGCCCTGGACGCAGACTTTCCGGGCGTGCCTGAGCGGGTAGTG
AGCTTCTATGCGATACTCGAGACGACCAAGGATTTGTCAGGCAAGGCCAGAGATGCGCTACGTGTCGAGTTCAAA
ACCGTCGACGAGGTCGGAGGCGCGCGCGAGTACGTCGAGGCGTTCCGGCGGCGGCACCCGAAGAGTCCGCGACAC
GCGCTGTCGGCGGTAGCGGCGAAAAGGCTACTCCCCGGGTTGGACCGGGCTTCGTGCGACAAGGAAGCGGCGGCG
CTGGTGGATATGGAGGGATCGACGAGCGACGACGCCGTCCGACTGCTGGATACTTTGCGCGGGTGGAGAAGCGGC
GAGGCGATGAGATTGAAAAAGGCAGCGCAAGCCAAGTGGCCCGAGGTGACGAGGCTGGCGTGA
Transcript >Ophun1|6406
ATGTCTTCCCCGCAGCCGTCGGCCGCAAAGACGACTGGAGCCGCAAAGAGCGGCTGGTTTTTCGCTCAGCATAGC
TCGCCGTATCCGCAGAACATGAGCCAGCTCCCGCAACGGCCACAACTAACACCGCAGTTCTGCTTTTCCACTGGG
ACGCTGCGTGGTAAGCCCAATTTCTACTCTGCCAATTTACACCTTTGCGAAGCCCGCTCATGCGAGCCGTTGATA
GACTTTTTGCGACTTTCCAGGTCTTCTGTTGACGACACCGTCTCCCAAAACCTCAATGCGCTCGTGACGCCCTCA
AAAAAGGGCTTCGATCCTGACTCGACGTCTCGGCGGTCGACGCCACCGACTTTACGAACCCTTGGTCGGCCCGCT
TGTCAGTCGTATTACGAAAACGTGCTCTTCCCTGCGTGGCAGGCGAGGACCGAGGTGCTCGACTACTGCGCTTTG
GTCGCCACCAGCCCCGATCCTAACGATCCGGAGGCTGCGCTTCGAGAGGCTGAAAACCAACAGGACCGTCAACGG
GTCGTGGACGAACGCCTGGATCCATACTCGGCCAGGTTTTTCCCGCGGGAGGCACGCACCCAGACACTAGCCAGC
ATTATCCGCCAGGAACGCGACGTTGAGAAAATCGTAAGGACTCAGTCCTGGAACGTTATCCAGCAGCGGTGCGCG
GCGCTGCGTGAGGACTATGACGACGCCGTCAGGAGATGGAGAGACGGGCAACCGTCTTCCCGATCAATCCCAAAG
ACGAAGCACCTACGCCTCGCCAAGTCGCCCACACAACGAGTCCGACGCCGTGCCTCGTCTGCGCTCGAAAGGTCG
GTAGACAGCTACGACCTGCGTCGCTGGGCCTCCGATAGGGACCCCGAACGGACTCCCGAAGATTCGGGCCTCCGA
AGAACCGGGTCCCCCGATATCCGATCAGCCTCACAGTCGCCCCCATCCCTACCCACGATGCCGCAGGCGCTGGGA
CCCAAGGAGGCGGCCAACTTTCGAGCCGTCATCCGAAGCTACGAGGACAAGCAGTACAAACGCGGCCTTAAGACT
GCCGACCTCATCCTAAAAAAACATCCCAAGCATGGCGACACAATGGCCATGAAGGCCCTGATTCTCAACAGCCAG
GGCAAGACGGACGAGGCTTTTGCACTAGCAAAGGAGGCCCTCAAGGTCGACATGAAGTCGCACATCTGCTGGCAC
GTCTATGGCCTGCTTTACCGCGCCAACAAAAACTTCGAGGAGGCCATCAAGGCCTACAAATTTGCACTCAAGCTC
GAGCCCGAGTCGCCGCAGATCCAGAGAGATCTCGCCATTCTTCAAGTCCAGATGCGTGATTACGCCGGATACATA
CAGAGTAGAACCGCTATGCTGCAGGCGCGGCCGCAGCTGCGTCAGAGCTGGACCGCCCTCGCCATCGCCCACCAT
CTGTCCGGTAACCTCGCTGAAGCGGAAAACGTACTCACGACGTACGAGGGCACGCTCAAGGCCACACCGCCGCGC
CACGATATCGAACACTCCGAGGCCGTCATGTACAAGAACTCGTTGATGGCCGAGCAGGGCGACTACCAACGGGCC
TTGGATCACCTCAACCGCGCCGCCAAGCACAATCTCGACCGGCTTGCCGTCATGGAGGCTCGAGCCGACTACCTC
GCCCGGCTGGGTCGAGAAGACGAGGCCGCAAAGGCGTACCGCGCTCTGCTTGACCGTAACTCGGAGCATCCGATT
TACTACGAGAAGCTGATAGCCGCGCTCGGCATCTCCCTCGACAACCTGACAGCACGCAAGGCCGTCTACGACGAA
TATGTGCGCAAGGCGCCGCGCGGGGACGCTGCCAGACGAATGCCCCTTGACTTTCTGCGAGGCAAGCAATCACGC
CCCCCCCTTCCTCCCCTGCCCGCGGCCAGGGAGTATCTGAAGCTCATGCTGGATAAGGGCGTGCCGTCGACGTTT
GCCAACCTCAAGCATCTCTATTCGGATTCGGAGAAGAAGAAGATATTGAGGGAGCTGGCAGAGGAATACCTCGAG
TCGCAAACGACAGACTCGTCGAGTAAGGACAAGGGCGAGGCGGCCGCGCTATTCTATCTCGCACAACACTACAAC
TACCACCTCAGCCGAGACTTGGATAAGGCGGCCGAGTACACGGAGCGAGCCATCGGAAAAGACGCCAAGAGCGTG
GATTTCCACATGACGAAAGCCAGGATACTGAAGCACCGTGGATATCTCCAGAAGGCCTCGGAGGCAATGGATTAT
GCACGGACGCTGGATCTTAAAGACCGATACATCAACAGCAAGGCGGCCAAGTACCAGCTGAGGAACAACGAGAAT
GAGCGCGCCCTCAAGACAGTCGGTCTGTTTACGCGAGCCGACACGGCGGGCGGCCCGCTGGCGGACCTGCTGGAC
ATGCAGTGCGTCTGGTACTTGACGGAGGACGGCGAGGCGCACGCGCGACAGGGCAACGTCGGGCTGGCGCTGAAG
CGATTCCTGGCCGTCACCAACATCTTTGACGTGTGGCAGGAAGACCAGTTCGACTTTCACAGCTTCTCGCTCCGC
AAGGGCCAGGTGCGAGCCTACATCGACATGATGCGATGGGAGGACCACGTGCGCGACCACCCGTTCTACTCGCGG
GCGGCGCTCAACGGGATCGGCGTCTACCTCGGTATGGCCGATAAGGCGGCGGCGGCGGCCAACGGCGTCAATGGG
GTCGAGGCAGCGGGCGGTGAGGACGCGCTGGCGGCGAAGAAGGCTGCAAAGAAGGCGCGCAAAGAGCAGCAGCGC
CTGGAACGAGAAGCGACCGAGAAACTGGCAAAACAGGACCCTAACAAGGGTGGCGGGGGCGAGGCTAAGAAGACG
GACGACGACCCGCTGGGCCTGAAGCTGGCGGCGACGACGGATCCGCTGGGCGAGGCCATGAAGCTGCTGGTGCCG
CTACTTCAGGCGTGTCCGAAGAGCATCGAGGCGCAGCTGGCGGGTTTCGACGTGTACATGCAGCGCAACAAGTAC
GTGCTGGCGCTACGGTGCCTCAAGGCGGCCGTCGCCCTGGACGCAGACTTTCCGGGCGTGCCTGAGCGGGTAGTG
AGCTTCTATGCGATACTCGAGACGACCAAGGATTTGTCAGGCAAGGCCAGAGATGCGCTACGTGTCGAGTTCAAA
ACCGTCGACGAGGTCGGAGGCGCGCGCGAGTACGTCGAGGCGTTCCGGCGGCGGCACCCGAAGAGTCCGCGACAC
GCGCTGTCGGCGGTAGCGGCGAAAAGGCTACTCCCCGGGTTGGACCGGGCTTCGTGCGACAAGGAAGCGGCGGCG
CTGGTGGATATGGAGGGATCGACGAGCGACGACGCCGTCCGACTGCTGGATACTTTGCGCGGGTGGAGAAGCGGC
GAGGCGATGAGATTGAAAAAGGCAGCGCAAGCCAAGTGGCCCGAGGTGACGAGGCTGGCGTGA
Gene >Ophun1|6406
ATGTCTTCCCCGCAGCCGTCGGCCGCAAAGACGACTGGAGCCGCAAAGAGCGGCTGGTTTTTCGCTCAGCATAGC
TCGCCGTATCCGCAGAACATGAGCCAGCTCCCGCAACGGCCACAACTAACACCGCAGTTCTGCTTTTCCACTGGG
ACGCTGCGTGGTAAGCCCAATTTCTACTCTGCCAATTTACACCTTTGCGAAGCCCGCTCATGCGAGCCGTTGATA
GACTTTTTGCGACTTTCCAGGTCTTCTGTTGACGACACCGTCTCCCAAAACCTCAATGCGCTCGTGACGCCCTCA
AAAAAGGGCTTCGATCCTGACTCGACGTCTCGGCGGTCGACGCCACCGACTTTACGAACCCTTGGTCGGCCCGCT
TGTCAGTCGTATTACGAAAACGTGCTCTTCCCTGCGTGGCAGGCGAGGACCGAGGTGCTCGACTACTGCGCTTTG
GTCGCCACCAGCCCCGATCCTAACGATCCGGAGGCTGCGCTTCGAGAGGCTGAAAACCAACAGGACCGTCAACGG
GTCGTGGACGAACGCCTGGATCCATACTCGGCCAGGTTTTTCCCGCGGGAGGCACGCACCCAGACACTAGCCAGC
ATTATCCGCCAGGAACGCGACGTTGAGAAAATCGTAAGGACTCAGTCCTGGAACGTTATCCAGCAGCGGTGCGCG
GCGCTGCGTGAGGACTATGACGACGCCGTCAGGAGATGGAGAGACGGGCAACCGTCTTCCCGGTACGCCAAATTC
TGAGAGCAAGTGGATAGGCACGGCTGCACTTTCATAAGCAGACATCATGACGGCGTTCATGTCTTGATCAGTATT
GGATCGAATCGGGCACGACGGAATCCGGGTTGTCGACAAACCTGCAGCCTAATGGATCCAAGGTTGATATTTTCG
TAGAACGTGGATAAGTGGATCAGGCAGAGGGCAAGACTTCATCTTGAAAACATGATCGTCTCTGCTTGTCGTTCG
CTCGTGCCGTGAAAATCGAATTGCTGGCTTCATTCGCTGCACGTTAAAGTCCATCATCGACGTCCAATCGCCCTG
TTCGATTATCAGTTTACAGTACGAACTGCTGGTACAGTGACAAAATGAGGGCAAAGCGCTGACTCGCGGCTCAGA
TTCCATCTTCGCACTGTAGTATTACATGCATCGCTCAAGATTTTTTTAGCGGGCTCTGCGGAAGGGAATTTTCCG
GCTACGGCTTCCATCAGATCAATCCCAAAGACGAAGCACCTACGCCTCGCCAAGTCGCCCACACAACGAGTCCGA
CGCCGTGCCTCGTCTGCGCTCGAAAGGTCGGTAGACAGCTACGACCTGCGTCGCTGGGCCTCCGATAGGGACCCC
GAACGGACTCCCGAAGATTCGGGCCTCCGAAGAACCGGGTCCCCCGATATCCGATCAGCCTCACAGTCGCCCCCA
TCCCTACCCACGATGCCGCAGGCGCTGGGACCCAAGGAGGCGGCCAACTTTCGAGCCGTCATCCGAAGCTACGAG
GACAAGCAGTACAAACGCGGCCTTAAGACTGCCGACCTCATCCTAAAAAAACATCCCAAGCATGGCGACACAATG
GCCATGAAGGCCCTGATTCTCAACAGCCAGGGCAAGACGGACGAGGCTTTTGCACTAGCAAAGGAGGCCCTCAAG
GTCGACATGAAGTCGCACATCTGCTGGCACGTCTATGGCCTGCTTTACCGCGCCAACAAAAACTTCGAGGAGGCC
ATCAAGGCCTACAAATTTGCACTCAAGCTCGAGCCCGAGTCGCCGCAGATCCAGAGAGATCTCGCCATTCTTCAA
GTCCAGATGCGTGATTACGCCGGATACATACAGAGTAGAACCGCTATGCTGCAGGCGCGGCCGCAGCTGCGTCAG
AGCTGGACCGCCCTCGCCATCGCCCACCATCTGTCCGGTAACCTCGCTGAAGCGGAAAACGTACTCACGACGTAC
GAGGGCACGCTCAAGGCCACACCGCCGCGCCACGATATCGAACACTCCGAGGCCGTCATGTACAAGAACTCGTTG
ATGGCCGAGCAGGGCGACTACCAACGGGCCTTGGATCACCTCAACCGCGCCGCCAAGCACAATCTCGACCGGCTT
GCCGTCATGGAGGCTCGAGCCGACTACCTCGCCCGGCTGGGTCGAGAAGACGAGGCCGCAAAGGCGTACCGCGCT
CTGCTTGACCGTAACTCGGAGCATCCGATTTACTACGAGAAGCTGATAGCCGCGCTCGGCATCTCCCTCGACAAC
CTGACAGCACGCAAGGCCGTCTACGACGAATATGTGCGCAAGGCGCCGCGCGGGGACGCTGCCAGACGAATGCCC
CTTGACTTTCTGCGAGGCAAGCAATCACGCCCCCCCCTTCCTCCCCTGCCCGTATGTTCGGATTCGAGCGATGGC
TGACCGTTTTTGACCGCAGGCCACGAGTTCAAGCAGGCGGCCAGGGAGTATCTGAAGCTCATGCTGGATAAGGGC
GTGCCGTCGACGTTTGCCAACCTCAAGCATCTCTATTCGGATTCGGAGAAGAAGAAGATATTGAGGGAGCTGGCA
GAGGAATACCTCGAGTCGCAAACGACAGACTCGTCGAGTAAGGACAAGGGCGAGGCGGCCGCGCTATTCTATCTC
GCACAACACTACAACTACCACCTCAGCCGAGACTTGGATAAGGCGGCCGAGTACACGGAGCGAGCCATCGGAAAA
GACGCCAAGAGCGTGGATTTCCACATGACGAAAGCCAGGATACTGAAGCACCGTGGATATCTCCAGAAGGCCTCG
GAGGCAATGGATTATGCACGGACGCTGGATCTTAAAGACCGATACATCAACAGCAAGGCGGCCAAGTACCAGCTG
AGGAACAACGAGAATGAGCGCGCCCTCAAGACAGTCGGTCTGTTTACGCGAGCCGACACGGCGGGCGGCCCGCTG
GCGGACCTGCTGGACATGCAGTGCGTCTGGTACTTGACGGAGGACGGCGAGGCGCACGCGCGACAGGGCAACGTC
GGGCTGGCGCTGAAGCGATTCCTGGCCGTCACCAACATCTTTGACGTGTGGCAGGAAGACCAGTTCGACTTTCAC
AGCTTCTCGCTCCGCAAGGGCCAGGTGCGAGCCTACATCGACATGATGCGATGGGAGGACCACGTGCGCGACCAC
CCGTTCTACTCGCGGGCGGCGCTCAACGGGATCGGCGTCTACCTCGGTATGGCCGATAAGGCGGCGGCGGCGGCC
AACGGCGTCAATGGGGTCGAGGCAGCGGGCGGTGAGGACGCGCTGGCGGCGAAGAAGGCTGCAAAGAAGGCGCGC
AAAGAGCAGCAGCGCCTGGAACGAGAAGCGACCGAGAAACTGGCAAAACAGGACCCTAACAAGGGTGGCGGGGGC
GAGGCTAAGAAGACGGACGACGACCCGCTGGGCCTGAAGCTGGCGGCGACGACGGATCCGCTGGGCGAGGCCATG
AAGCTGCTGGTGCCGCTACTTCAGGCGTGTCCGAAGAGCATCGAGGCGCAGCTGGCGGGTTTCGACGTGTACATG
CAGCGCAGTGAGTTTGCAGTGCCCAGTGACGGGTGAGGGAGAAACGGTGAAAGAGCTGACGACGGGAAAAACAGA
CAAGTACGTGCTGGCGCTACGGTGCCTCAAGGCGGCCGTCGCCCTGGACGCAGACTTTCCGGGCGTGCCTGAGCG
GGTAGTGAGCTTCTATGCGATACTCGAGACGACCAAGGATTTGTCAGGCAAGGCCAGAGATGCGCTACGTGTCGA
GTTCAAAACCGTCGACGAGGTCGGAGGCGCGCGCGAGTACGTCGAGGCGTTCCGGCGGCGGCACCCGAAGAGTCC
GCGACACGCGCTGTCGGCGGTAGCGGCGAAAAGGCTACTCCCCGGGTTGGACCGGGCTTCGTGCGACAAGGAAGC
GGCGGCGCTGGTGGATATGGAGGGATCGACGAGCGACGACGCCGTCCGACTGCTGGATACTTTGCGCGGGTGGAG
AAGCGGCGAGGCGATGAGATTGAAAAAGGCAGCGCAAGCCAAGTGGCCCGAGGTGACGAGGCTGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail