Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6405
Gene name
LocationContig_7:11831..13554
Strand-
Gene length (bp)1723
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 1.3E-25 135 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06147|LCB5_YEAST Sphingoid long chain base kinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB5 PE=1 SV=1 88 492 9.0E-69
sp|Q12246|LCB4_YEAST Sphingoid long chain base kinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB4 PE=1 SV=1 118 492 7.0E-65
sp|O14159|LCB4_SCHPO Sphingoid long chain base kinase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb4 PE=3 SV=1 70 493 1.0E-58
sp|Q9NYA1|SPHK1_HUMAN Sphingosine kinase 1 OS=Homo sapiens GN=SPHK1 PE=1 SV=1 136 479 5.0E-34
sp|Q8CI15|SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus GN=Sphk1 PE=1 SV=1 135 498 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06147|LCB5_YEAST Sphingoid long chain base kinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB5 PE=1 SV=1 88 492 9.0E-69
sp|Q12246|LCB4_YEAST Sphingoid long chain base kinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB4 PE=1 SV=1 118 492 7.0E-65
sp|O14159|LCB4_SCHPO Sphingoid long chain base kinase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb4 PE=3 SV=1 70 493 1.0E-58
sp|Q9NYA1|SPHK1_HUMAN Sphingosine kinase 1 OS=Homo sapiens GN=SPHK1 PE=1 SV=1 136 479 5.0E-34
sp|Q8CI15|SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus GN=Sphk1 PE=1 SV=1 135 498 2.0E-33
sp|Q91V26|SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus GN=Sphk1 PE=2 SV=1 136 479 8.0E-33
sp|Q8L7L1|SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana GN=SPHK1 PE=1 SV=1 133 467 3.0E-27
sp|Q9NRA0|SPHK2_HUMAN Sphingosine kinase 2 OS=Homo sapiens GN=SPHK2 PE=1 SV=2 139 315 2.0E-25
sp|F2Y4A3|SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana GN=SPHK2 PE=1 SV=1 124 467 5.0E-25
sp|Q86KF9|SPHKA_DICDI Sphingosine kinase A OS=Dictyostelium discoideum GN=sgkA PE=2 SV=2 115 315 8.0E-25
sp|Q9JIA7|SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus GN=Sphk2 PE=1 SV=2 136 315 3.0E-22
sp|Q18425|SPHK1_CAEEL Sphingosine kinase 1 OS=Caenorhabditis elegans GN=sphk-1 PE=1 SV=1 115 315 3.0E-16
sp|Q8TCT0|CERK1_HUMAN Ceramide kinase OS=Homo sapiens GN=CERK PE=1 SV=1 133 315 8.0E-16
sp|Q9LRB0|LCBK1_ARATH Sphingoid long-chain bases kinase 1 OS=Arabidopsis thaliana GN=LCBK1 PE=1 SV=1 136 316 1.0E-14
sp|Q8K4Q7|CERK1_MOUSE Ceramide kinase OS=Mus musculus GN=Cerk PE=2 SV=2 133 330 3.0E-14
sp|Q6B516|SPHKB_DICDI Sphingosine kinase B OS=Dictyostelium discoideum GN=sgkB PE=2 SV=1 127 267 2.0E-12
sp|Q7ZYJ3|AGK_XENLA Acylglycerol kinase, mitochondrial OS=Xenopus laevis GN=agk PE=2 SV=1 123 300 2.0E-12
sp|Q53H12|AGK_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens GN=AGK PE=1 SV=2 133 305 7.0E-12
sp|Q5RED7|AGK_PONAB Acylglycerol kinase, mitochondrial OS=Pongo abelii GN=AGK PE=2 SV=1 133 305 1.0E-11
sp|Q9ESW4|AGK_MOUSE Acylglycerol kinase, mitochondrial OS=Mus musculus GN=Agk PE=1 SV=1 133 305 2.0E-11
sp|Q7ZW00|AGK_DANRE Acylglycerol kinase, mitochondrial OS=Danio rerio GN=agk PE=2 SV=2 123 290 2.0E-11
sp|C0LT23|CERK_ORYSJ Ceramide kinase OS=Oryza sativa subsp. japonica GN=CERK PE=1 SV=1 133 209 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4397
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4192
Ophiocordyceps australis map64 (Brazil) OphauB2|8081
Ophiocordyceps camponoti-floridani Ophcf2|04712
Ophiocordyceps camponoti-rufipedis Ophun1|6405 (this protein)
Ophiocordyceps kimflemingae Ophio5|7739
Ophiocordyceps subramaniannii Hirsu2|9104

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6405
MNSDVAKADNESSPCLRTLSLGESELLLDEDPAVLESVNTSRNHRRKPTRSCCTFLNVGVADASAHRILVPLYDV
LWASSSSGSHVTVDYVVASGSSLRLESWTGRVDATSPSPEAFVSTLLARAYGDARARKSALVVVNPNSGPGGALA
KWERHVKPLFEAARMTFDVIVLERGGEAADLAEGIDLLRYDIMVACSGDGTPHEIFNGLARRPDAARALSTIAVA
LIPCGSGNAMACNLYGSHRPALAAQAIIKGVVTPLDLVSITQGDRRSVSFLSQALGIVAESDLATEHLRWMGSFR
FDVGVFTRLFRRKCYPCDLAVKVEADETLGKNGVRAHYSRHVVDGSPEVGSPAVDGGLPPLRFGTVQDELPEGWE
LIPHDKIGLFYCGNMAYMAPDVNLFSAALASDGCMDLVLMRGDLWPVTALKTLLSAQKGRLFDNRHVSYRKVSAY
RIIPRGQDDGYISIDGERAPFAPFQAEVHRALGRVISKRGRFETPGPPGLESTGPAEGGDSG*
Coding >Ophun1|6405
ATGAACAGCGACGTGGCCAAGGCTGACAACGAGTCCAGCCCGTGCCTGCGGACGCTGAGCTTGGGCGAGAGCGAG
CTGCTCCTCGACGAAGATCCGGCTGTGCTGGAGTCGGTTAATACCAGCAGGAATCATCGTCGGAAGCCGACGCGC
TCTTGTTGCACCTTTCTCAACGTCGGGGTCGCGGATGCATCGGCCCATCGAATACTGGTGCCGCTGTACGACGTG
CTGTGGGCGTCGTCGTCGTCTGGTTCCCACGTCACCGTCGACTATGTCGTCGCATCAGGCTCCTCGCTGCGGCTG
GAGTCTTGGACGGGCCGCGTCGATGCTACATCGCCTTCGCCCGAGGCATTCGTCTCGACGCTGCTGGCACGCGCC
TACGGAGATGCAAGAGCGCGGAAGAGCGCGCTGGTCGTCGTCAATCCCAACTCCGGCCCCGGGGGTGCCCTGGCC
AAGTGGGAGCGTCATGTCAAGCCCTTATTCGAGGCCGCGCGCATGACCTTTGATGTCATTGTCCTTGAGCGCGGC
GGCGAGGCGGCCGACCTGGCCGAGGGCATCGATCTGCTTCGTTACGATATCATGGTCGCCTGCTCCGGAGACGGA
ACTCCGCATGAAATTTTCAATGGCTTGGCCCGGCGGCCCGACGCTGCCCGCGCGCTGTCCACGATCGCCGTCGCC
CTTATCCCATGCGGCTCCGGCAATGCCATGGCTTGCAATCTATACGGCTCGCATCGGCCCGCGCTGGCGGCGCAG
GCCATCATCAAGGGAGTCGTCACCCCCTTGGATCTCGTCTCCATCACGCAAGGCGACCGCCGTTCTGTCTCCTTT
CTATCCCAAGCGCTCGGCATTGTGGCCGAGAGCGACCTGGCGACGGAACATCTGCGCTGGATGGGGAGCTTTCGC
TTTGACGTCGGCGTCTTCACCCGCCTCTTCCGCCGCAAGTGCTACCCCTGTGATTTGGCCGTCAAGGTCGAGGCC
GATGAGACGCTCGGTAAGAACGGCGTGCGGGCTCACTACAGCCGGCACGTCGTCGACGGGAGCCCGGAAGTCGGT
TCACCTGCTGTCGATGGTGGCTTGCCTCCCCTACGGTTTGGCACCGTGCAGGATGAGCTGCCCGAAGGCTGGGAG
TTGATTCCTCATGATAAGATTGGCCTTTTTTATTGCGGCAACATGGCTTACATGGCACCCGATGTCAACTTATTT
TCGGCCGCCCTCGCCTCGGACGGCTGCATGGACCTGGTCCTGATGAGGGGAGACTTGTGGCCGGTGACGGCCCTC
AAGACGCTCCTGTCGGCGCAAAAGGGCCGCCTCTTCGATAACCGCCACGTATCGTACCGCAAGGTCTCGGCCTAC
CGCATCATCCCGCGCGGCCAAGACGATGGCTACATCAGCATCGATGGCGAACGCGCGCCCTTTGCGCCCTTCCAG
GCCGAGGTTCACAGGGCGCTCGGAAGGGTCATCTCCAAGCGCGGCCGCTTCGAGACGCCCGGGCCGCCTGGCTTG
GAGTCCACTGGGCCGGCTGAGGGAGGGGATAGCGGTTGA
Transcript >Ophun1|6405
ATGAACAGCGACGTGGCCAAGGCTGACAACGAGTCCAGCCCGTGCCTGCGGACGCTGAGCTTGGGCGAGAGCGAG
CTGCTCCTCGACGAAGATCCGGCTGTGCTGGAGTCGGTTAATACCAGCAGGAATCATCGTCGGAAGCCGACGCGC
TCTTGTTGCACCTTTCTCAACGTCGGGGTCGCGGATGCATCGGCCCATCGAATACTGGTGCCGCTGTACGACGTG
CTGTGGGCGTCGTCGTCGTCTGGTTCCCACGTCACCGTCGACTATGTCGTCGCATCAGGCTCCTCGCTGCGGCTG
GAGTCTTGGACGGGCCGCGTCGATGCTACATCGCCTTCGCCCGAGGCATTCGTCTCGACGCTGCTGGCACGCGCC
TACGGAGATGCAAGAGCGCGGAAGAGCGCGCTGGTCGTCGTCAATCCCAACTCCGGCCCCGGGGGTGCCCTGGCC
AAGTGGGAGCGTCATGTCAAGCCCTTATTCGAGGCCGCGCGCATGACCTTTGATGTCATTGTCCTTGAGCGCGGC
GGCGAGGCGGCCGACCTGGCCGAGGGCATCGATCTGCTTCGTTACGATATCATGGTCGCCTGCTCCGGAGACGGA
ACTCCGCATGAAATTTTCAATGGCTTGGCCCGGCGGCCCGACGCTGCCCGCGCGCTGTCCACGATCGCCGTCGCC
CTTATCCCATGCGGCTCCGGCAATGCCATGGCTTGCAATCTATACGGCTCGCATCGGCCCGCGCTGGCGGCGCAG
GCCATCATCAAGGGAGTCGTCACCCCCTTGGATCTCGTCTCCATCACGCAAGGCGACCGCCGTTCTGTCTCCTTT
CTATCCCAAGCGCTCGGCATTGTGGCCGAGAGCGACCTGGCGACGGAACATCTGCGCTGGATGGGGAGCTTTCGC
TTTGACGTCGGCGTCTTCACCCGCCTCTTCCGCCGCAAGTGCTACCCCTGTGATTTGGCCGTCAAGGTCGAGGCC
GATGAGACGCTCGGTAAGAACGGCGTGCGGGCTCACTACAGCCGGCACGTCGTCGACGGGAGCCCGGAAGTCGGT
TCACCTGCTGTCGATGGTGGCTTGCCTCCCCTACGGTTTGGCACCGTGCAGGATGAGCTGCCCGAAGGCTGGGAG
TTGATTCCTCATGATAAGATTGGCCTTTTTTATTGCGGCAACATGGCTTACATGGCACCCGATGTCAACTTATTT
TCGGCCGCCCTCGCCTCGGACGGCTGCATGGACCTGGTCCTGATGAGGGGAGACTTGTGGCCGGTGACGGCCCTC
AAGACGCTCCTGTCGGCGCAAAAGGGCCGCCTCTTCGATAACCGCCACGTATCGTACCGCAAGGTCTCGGCCTAC
CGCATCATCCCGCGCGGCCAAGACGATGGCTACATCAGCATCGATGGCGAACGCGCGCCCTTTGCGCCCTTCCAG
GCCGAGGTTCACAGGGCGCTCGGAAGGGTCATCTCCAAGCGCGGCCGCTTCGAGACGCCCGGGCCGCCTGGCTTG
GAGTCCACTGGGCCGGCTGAGGGAGGGGATAGCGGTTGA
Gene >Ophun1|6405
ATGAACAGCGACGTGGCCAAGGCTGACAACGAGTCCAGCCCGTGCCTGCGGACGCTGAGCTTGGGCGAGAGCGAG
CTGCTCCTCGACGGTGCGGCCCTCGAGATATGCCGTCTGCGTTTTGCTGCTAATGATGGGAGTTGCAGAAGATCC
GGCTGTGCTGGAGTCGGTTAATACCAGCAGGAATCATCGTCGGAAGCCGACGCGCTCTTGTTGCACCTTTCTCAA
CGTCGGGGTCGCGGGTACGTGAAGCCCCTGACCCCCCGGTCTTCCATCACCACGCTCAAGCCCGTTTTCCTTCCA
AGATGCATCGGCCCATCGAATACTGGTGCCGCTGTACGACGTGCTGTGGGCGTCGTCGTCGTCTGGTTCCCACGT
CACCGTCGACTATGTCGTCGCATCAGGCTCCTCGCTGCGGCTGGAGTCTTGGACGGGCCGCGTCGATGCTACATC
GCCTTCGCCCGAGGCATTCGTCTCGACGCTGCTGGCACGCGCCTACGGAGATGCAAGAGCGCGGAAGAGCGCGCT
GGTCGTCGTCAATCCCAACTCCGGCCCCGGGGGTGCCCTGGCCAAGTGGGAGCGTCATGTCAAGCCCTTATTCGA
GGCCGCGCGCATGACCTTTGATGTCATTGTCCTTGAGCGCGGCGGCGAGGCGGCCGACCTGGCCGAGGGCATCGA
TCTGCTTCGTTACGATATCATGGTCGCCTGCTCCGGAGACGGAACTCCGCATGAAATTTTCAATGGCTTGGCCCG
GCGGCCCGACGCTGCCCGCGCGCTGTCCACGATCGCCGTCGCCCTTATCCCATGCGGCTCCGGCAATGCCATGGC
TTGCAATCTATACGGCTCGCATCGGCCCGCGCTGGCGGCGCAGGCCATCATCAAGGGAGTCGTCACCCCCTTGGA
TCTCGTCTCCATCACGCAAGGCGACCGCCGTTCTGTCTCCTTTCTATCCCAAGCGCTCGGCATTGTGGCCGAGAG
CGACCTGGCGACGGAACATCTGCGCTGGATGGGGAGCTTTCGCTTTGACGTCGGCGTCTTCACCCGCCTCTTCCG
CCGCAAGTGCTACCCCTGTGATTTGGCCGTCAAGGTCGAGGCCGATGAGACGCTCGGTAAGAACGGCGTGCGGGC
TCACTACAGCCGGCACGTCGTCGACGGGAGCCCGGAAGTCGGTTCACCTGCTGTCGATGGTGGCTTGCCTCCCCT
ACGGTTTGGCACCGTGCAGGATGAGCTGCCCGAAGGCTGGGAGTTGATTCCTCATGATAAGATTGGCCTTTTTTA
TTGCGGCAACGTGAGATGCCCCTACCCAATCACCTCTTTACGTATCGTCTCCGCTCACACATTTTCTCACGCTCA
GATGGCTTACATGGCACCCGATGTCAACTTATTTTCGGCCGCCCTCGCCTCGGACGGCTGCATGGACCTGGTCCT
GATGAGGGGAGACTTGTGGCCGGTGACGGCCCTCAAGACGCTCCTGTCGGCGCAAAAGGGCCGCCTCTTCGATAA
CCGCCACGTATCGTACCGCAAGGTCTCGGCCTACCGCATCATCCCGCGCGGCCAAGACGATGGCTACATCAGCAT
CGATGGCGAACGCGCGCCCTTTGCGCCCTTCCAGGCCGAGGTTCACAGGGCGCTCGGAAGGGTCATCTCCAAGCG
CGGCCGCTTCGAGACGCCCGGGCCGCCTGGCTTGGAGTCCACTGGGCCGGCTGAGGGAGGGGATAGCGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail