Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6401
Gene name
LocationContig_7:2521..5570
Strand+
Gene length (bp)3049
Transcript length (bp)2871
Coding sequence length (bp)2871
Protein length (aa) 957

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 4.0E-90 28 490
PF07718 Coatamer_beta_C Coatomer beta C-terminal region 2.6E-59 678 814
PF14806 Coatomer_b_Cpla Coatomer beta subunit appendage platform 3.7E-55 819 945
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 8.8E-09 116 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R922|COPB_PONAB Coatomer subunit beta OS=Pongo abelii GN=COPB1 PE=2 SV=1 8 944 0.0E+00
sp|Q9UUF7|COPB_SCHPO Coatomer subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec26 PE=3 SV=1 7 946 0.0E+00
sp|Q23924|COPB_DICDI Coatomer subunit beta OS=Dictyostelium discoideum GN=copb PE=2 SV=2 2 948 0.0E+00
sp|Q9SV21|COPB1_ARATH Coatomer subunit beta-1 OS=Arabidopsis thaliana GN=At4g31480 PE=2 SV=2 11 954 0.0E+00
sp|Q0JNK5|COPB2_ORYSJ Coatomer subunit beta-2 OS=Oryza sativa subsp. japonica GN=Os01g0281400 PE=3 SV=1 11 953 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R922|COPB_PONAB Coatomer subunit beta OS=Pongo abelii GN=COPB1 PE=2 SV=1 8 944 0.0E+00
sp|Q9UUF7|COPB_SCHPO Coatomer subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec26 PE=3 SV=1 7 946 0.0E+00
sp|Q23924|COPB_DICDI Coatomer subunit beta OS=Dictyostelium discoideum GN=copb PE=2 SV=2 2 948 0.0E+00
sp|Q9SV21|COPB1_ARATH Coatomer subunit beta-1 OS=Arabidopsis thaliana GN=At4g31480 PE=2 SV=2 11 954 0.0E+00
sp|Q0JNK5|COPB2_ORYSJ Coatomer subunit beta-2 OS=Oryza sativa subsp. japonica GN=Os01g0281400 PE=3 SV=1 11 953 0.0E+00
sp|Q53PC7|COPB1_ORYSJ Coatomer subunit beta-1 OS=Oryza sativa subsp. japonica GN=Os11g0174000 PE=2 SV=1 11 953 0.0E+00
sp|Q9SV20|COPB2_ARATH Coatomer subunit beta-2 OS=Arabidopsis thaliana GN=At4g31490 PE=2 SV=2 11 953 0.0E+00
sp|Q29G21|COPB_DROPS Coatomer subunit beta OS=Drosophila pseudoobscura pseudoobscura GN=betaCOP PE=3 SV=2 19 944 0.0E+00
sp|P45437|COPB_DROME Coatomer subunit beta OS=Drosophila melanogaster GN=betaCOP PE=2 SV=2 16 944 0.0E+00
sp|P53618|COPB_HUMAN Coatomer subunit beta OS=Homo sapiens GN=COPB1 PE=1 SV=3 8 944 0.0E+00
sp|D2SW95|COPB_PIG Coatomer subunit beta OS=Sus scrofa GN=COPB1 PE=2 SV=1 8 944 0.0E+00
sp|Q9JIF7|COPB_MOUSE Coatomer subunit beta OS=Mus musculus GN=Copb1 PE=1 SV=1 8 944 0.0E+00
sp|A0JN39|COPB_BOVIN Coatomer subunit beta OS=Bos taurus GN=COPB1 PE=1 SV=1 8 944 0.0E+00
sp|P23514|COPB_RAT Coatomer subunit beta OS=Rattus norvegicus GN=Copb1 PE=1 SV=1 8 944 0.0E+00
sp|Q5ZIA5|COPB_CHICK Coatomer subunit beta OS=Gallus gallus GN=COPB1 PE=2 SV=1 8 944 0.0E+00
sp|Q66HV4|COPB_DANRE Coatomer subunit beta OS=Danio rerio GN=copb1 PE=2 SV=1 8 944 0.0E+00
sp|Q6FM46|COPB_CANGA Coatomer subunit beta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC26 PE=3 SV=1 8 944 0.0E+00
sp|P41810|COPB_YEAST Coatomer subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC26 PE=1 SV=2 8 944 0.0E+00
sp|Q9NFU6|COPB_TRYBB Coatomer subunit beta OS=Trypanosoma brucei brucei PE=3 SV=1 25 951 5.0E-156
sp|Q9U4N3|COPB_TOXGO Coatomer subunit beta OS=Toxoplasma gondii PE=2 SV=2 5 581 6.0E-97
sp|Q9U4N3|COPB_TOXGO Coatomer subunit beta OS=Toxoplasma gondii PE=2 SV=2 687 944 9.0E-53
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 23 463 1.0E-21
sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 23 463 7.0E-16
sp|Q08DS7|AP1B1_BOVIN AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1 23 463 8.0E-16
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 23 463 2.0E-15
sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 23 463 2.0E-15
sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 23 463 2.0E-15
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 23 463 4.0E-15
sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 74 463 4.0E-14
sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=2 74 463 4.0E-14
sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 74 463 6.0E-14
sp|Q8L7A9|AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana GN=At1g31730 PE=1 SV=1 98 462 9.0E-12
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 17 461 3.0E-10
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 17 461 3.0E-10
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 332 463 8.0E-09
sp|O00203|AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens GN=AP3B1 PE=1 SV=3 17 167 2.0E-07
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 25 167 2.0E-07
sp|Q9LDK9|APBLA_ARATH Beta-adaptin-like protein A OS=Arabidopsis thaliana GN=BETAA-AD PE=1 SV=1 23 200 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005198 structural molecule activity Yes
GO:0030126 COPI vesicle coat Yes
GO:0006886 intracellular protein transport Yes
GO:0030117 membrane coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0030120 vesicle coat No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4402
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6502
Ophiocordyceps australis map64 (Brazil) OphauB2|8076
Ophiocordyceps camponoti-floridani Ophcf2|04716
Ophiocordyceps camponoti-rufipedis Ophun1|6401 (this protein)
Ophiocordyceps kimflemingae Ophio5|6180
Ophiocordyceps subramaniannii Hirsu2|9111

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6401
MSGFLENAYSLVHQDNAADVPTVSDLRLQLEKGTDEVKVDTMKHILTIMLNGDPMPTLLMHIIRFVMPSKHKPLK
KLLYFYYEICPKLDAGGKLKQEMILVCNGIRNDLQHPNEYIRGNTLRFLCKLREPELIEPLLSSARLCLEHRHAY
VRKNAVFAVSCIHSHSPSLIPDASELISTFLEGETDATCKRNAFAALASINHDAALRYLSSVFDGIPNAADLLQL
VEIEFIRKDAVQNSQNKARYLRLIFDLLDAGASTVVYEAASSLTALTNNPVAVKAAASKFIELSIKEADNNVKLI
VLDRVDQLRKKNEGILDDLTMELLRVLSSPDIDVRRKALSIALDMVSSRNVEEVVLLFKKELSKTVDQEYEKNAE
YRSLLIHSIHQCAIKFSEIAASVVELLMDFIADFNNASAVDVINFVKEVVEKFPNLRKTIVERLVLTLSEVRAGK
VYRGIMWIIGEYSLEEADIRDAWKRIRASLGEIPILASEQRLLEEHDGDKGDEKVNGSSKPAAPSGSRKVLADGT
YATETALTSQSSAAARLEAVKAAQKPPLRQLILDGDYYLATVLSSTLVKLVLRHSEVSADKARTNALRAEAMLIM
ISILRVGQSQFVKAPVDEDSVDRIMSCVRSLADFKERKELESVWLDDTKKAFRAMVQAEEKKRAAKEAYEKAKAA
TQVDDVVQIRQLSKKNHSTDLDEIEVDLERATGGEATTEDLSSKLSRVFQLTGFSDPVYAEAYVKVHQFDIVLDV
LLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGAHDFHNVQCTIKVSSTDTGVIFGNVVYDGAHSTDTNVVIL
NDMHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKASSLRAFLDQLKACTNMNCLTPEASLRGDCQFLSAN
LYARTVFGEDALANLSIEKEGENGPITGFVRIRSRSQGLALSLGSLKGLNKIGTPA*
Coding >Ophun1|6401
ATGTCTGGCTTCCTCGAGAATGCCTACAGCCTGGTGCATCAGGACAATGCCGCCGACGTGCCTACCGTCTCCGAC
CTGCGCCTACAGCTAGAGAAGGGCACCGACGAAGTCAAGGTCGACACCATGAAGCACATCCTGACAATTATGCTC
AATGGAGACCCGATGCCCACCCTACTCATGCACATAATACGATTTGTCATGCCCTCCAAGCACAAGCCTCTCAAA
AAGCTGCTGTACTTTTACTACGAAATCTGCCCCAAGCTTGATGCGGGCGGCAAGCTGAAACAAGAGATGATATTG
GTCTGCAATGGCATCCGCAACGACCTCCAACATCCCAACGAGTACATACGGGGGAATACGCTGCGATTCCTTTGC
AAGCTGCGTGAGCCGGAATTGATCGAACCTCTCCTCTCATCAGCGCGGCTGTGTCTCGAACACAGGCATGCCTAC
GTGCGAAAGAATGCCGTCTTCGCTGTGTCGTGCATACACTCACACTCGCCGTCTCTCATCCCCGATGCCTCCGAG
CTCATATCGACCTTTCTTGAAGGGGAAACGGACGCTACGTGCAAGAGAAACGCATTCGCGGCACTGGCGAGCATA
AACCACGACGCCGCGCTTCGCTACCTCAGCTCCGTCTTTGATGGTATACCCAACGCCGCCGATCTTCTGCAGCTG
GTGGAGATTGAGTTCATCCGCAAGGATGCGGTTCAGAATTCGCAGAATAAGGCCCGTTACCTGAGATTGATCTTT
GACCTGCTGGATGCTGGAGCGTCCACCGTGGTGTACGAAGCCGCCTCATCCCTGACAGCTCTTACGAATAATCCG
GTCGCCGTCAAGGCAGCGGCCTCCAAGTTTATCGAGCTGAGCATCAAGGAGGCGGACAACAACGTCAAGCTCATT
GTTCTCGATCGAGTTGACCAGCTGCGGAAAAAGAATGAGGGCATTCTGGATGACCTGACGATGGAGCTTCTCCGC
GTTCTGTCCAGTCCAGACATTGATGTACGCAGGAAGGCCCTGAGCATCGCGCTGGACATGGTTTCGAGCCGGAAT
GTCGAAGAGGTCGTCCTCCTCTTCAAGAAAGAACTGTCCAAGACGGTGGATCAGGAGTACGAGAAGAACGCCGAA
TACCGGTCTCTCCTGATCCACTCCATCCATCAGTGCGCCATTAAGTTTTCTGAAATAGCCGCCAGCGTGGTCGAG
CTGTTGATGGACTTTATCGCCGATTTCAACAACGCGTCAGCCGTCGATGTCATCAACTTCGTCAAAGAGGTCGTT
GAGAAGTTTCCGAATCTGCGAAAGACAATCGTTGAGCGGCTTGTGTTAACGCTCAGCGAAGTCCGCGCGGGAAAA
GTTTACCGAGGGATCATGTGGATCATCGGCGAATACTCGCTGGAAGAGGCGGACATTCGCGACGCATGGAAGCGC
ATACGGGCCAGTCTCGGCGAGATCCCTATCCTTGCCTCGGAGCAGCGACTTCTGGAGGAGCATGACGGAGACAAA
GGCGACGAGAAGGTCAATGGCAGCTCGAAGCCGGCGGCGCCGAGCGGCTCCCGCAAGGTGCTCGCCGACGGCACC
TATGCGACAGAGACGGCGCTCACCAGCCAGTCGTCGGCTGCCGCTAGACTGGAAGCCGTCAAGGCCGCTCAGAAG
CCCCCGCTGCGGCAGCTCATTCTCGATGGAGACTACTACCTGGCAACCGTTCTATCGTCGACGTTGGTGAAGCTC
GTCCTGCGGCACTCTGAGGTATCCGCAGACAAGGCGCGCACTAACGCTCTGCGGGCTGAGGCCATGCTCATCATG
ATTTCCATCCTTCGCGTCGGGCAATCCCAGTTTGTCAAGGCGCCGGTAGACGAAGACTCGGTCGATCGCATCATG
TCTTGCGTCCGCTCCTTGGCCGACTTCAAAGAGCGAAAGGAGCTGGAATCAGTTTGGTTGGACGATACGAAAAAA
GCTTTTCGGGCCATGGTCCAGGCCGAAGAGAAGAAGCGGGCGGCCAAGGAGGCGTATGAGAAGGCCAAGGCGGCC
ACGCAAGTCGACGACGTTGTCCAGATCCGGCAGTTGTCCAAGAAGAACCATTCAACGGACCTGGACGAGATCGAG
GTCGACCTGGAGAGGGCGACGGGTGGCGAAGCAACGACGGAGGACCTTTCGTCCAAGCTCAGCCGCGTCTTCCAG
CTGACGGGCTTCTCAGATCCTGTCTACGCTGAGGCGTACGTCAAGGTGCACCAATTCGATATCGTGCTCGACGTG
CTCCTCGTCAACCAGACGACGGAGACGCTACAGAACCTGTCGGTGGAATTCGCGACGCTCGGCGATCTGAAGGTG
GTAGAGCGGCCAACGACACAAAACCTAGGCGCGCACGACTTCCACAACGTCCAGTGCACCATCAAGGTATCGTCG
ACAGACACGGGCGTCATTTTCGGCAATGTCGTTTACGACGGGGCTCACTCGACGGACACAAACGTCGTCATTCTC
AACGACATGCATGTGGACATTATGGATTATATACAGCCGGCTACCTGCACGGAGACGCAATTCCGAACCATGTGG
ACCGAGTTCGAATGGGAGAACAAGGTAAACATCAACTCCAAGGCCAGCTCGCTCCGAGCCTTCCTGGACCAGCTC
AAAGCGTGCACCAACATGAACTGCCTCACGCCCGAGGCCAGCCTGAGGGGAGACTGCCAGTTCCTGAGCGCCAAT
TTGTATGCTCGCACCGTATTCGGCGAGGACGCTCTGGCCAACTTGAGCATCGAGAAGGAGGGTGAAAACGGGCCG
ATCACCGGCTTTGTTAGGATCAGAAGCCGGTCGCAAGGCCTGGCCTTGAGCCTGGGCTCACTGAAGGGACTCAAC
AAGATAGGCACCCCGGCATAA
Transcript >Ophun1|6401
ATGTCTGGCTTCCTCGAGAATGCCTACAGCCTGGTGCATCAGGACAATGCCGCCGACGTGCCTACCGTCTCCGAC
CTGCGCCTACAGCTAGAGAAGGGCACCGACGAAGTCAAGGTCGACACCATGAAGCACATCCTGACAATTATGCTC
AATGGAGACCCGATGCCCACCCTACTCATGCACATAATACGATTTGTCATGCCCTCCAAGCACAAGCCTCTCAAA
AAGCTGCTGTACTTTTACTACGAAATCTGCCCCAAGCTTGATGCGGGCGGCAAGCTGAAACAAGAGATGATATTG
GTCTGCAATGGCATCCGCAACGACCTCCAACATCCCAACGAGTACATACGGGGGAATACGCTGCGATTCCTTTGC
AAGCTGCGTGAGCCGGAATTGATCGAACCTCTCCTCTCATCAGCGCGGCTGTGTCTCGAACACAGGCATGCCTAC
GTGCGAAAGAATGCCGTCTTCGCTGTGTCGTGCATACACTCACACTCGCCGTCTCTCATCCCCGATGCCTCCGAG
CTCATATCGACCTTTCTTGAAGGGGAAACGGACGCTACGTGCAAGAGAAACGCATTCGCGGCACTGGCGAGCATA
AACCACGACGCCGCGCTTCGCTACCTCAGCTCCGTCTTTGATGGTATACCCAACGCCGCCGATCTTCTGCAGCTG
GTGGAGATTGAGTTCATCCGCAAGGATGCGGTTCAGAATTCGCAGAATAAGGCCCGTTACCTGAGATTGATCTTT
GACCTGCTGGATGCTGGAGCGTCCACCGTGGTGTACGAAGCCGCCTCATCCCTGACAGCTCTTACGAATAATCCG
GTCGCCGTCAAGGCAGCGGCCTCCAAGTTTATCGAGCTGAGCATCAAGGAGGCGGACAACAACGTCAAGCTCATT
GTTCTCGATCGAGTTGACCAGCTGCGGAAAAAGAATGAGGGCATTCTGGATGACCTGACGATGGAGCTTCTCCGC
GTTCTGTCCAGTCCAGACATTGATGTACGCAGGAAGGCCCTGAGCATCGCGCTGGACATGGTTTCGAGCCGGAAT
GTCGAAGAGGTCGTCCTCCTCTTCAAGAAAGAACTGTCCAAGACGGTGGATCAGGAGTACGAGAAGAACGCCGAA
TACCGGTCTCTCCTGATCCACTCCATCCATCAGTGCGCCATTAAGTTTTCTGAAATAGCCGCCAGCGTGGTCGAG
CTGTTGATGGACTTTATCGCCGATTTCAACAACGCGTCAGCCGTCGATGTCATCAACTTCGTCAAAGAGGTCGTT
GAGAAGTTTCCGAATCTGCGAAAGACAATCGTTGAGCGGCTTGTGTTAACGCTCAGCGAAGTCCGCGCGGGAAAA
GTTTACCGAGGGATCATGTGGATCATCGGCGAATACTCGCTGGAAGAGGCGGACATTCGCGACGCATGGAAGCGC
ATACGGGCCAGTCTCGGCGAGATCCCTATCCTTGCCTCGGAGCAGCGACTTCTGGAGGAGCATGACGGAGACAAA
GGCGACGAGAAGGTCAATGGCAGCTCGAAGCCGGCGGCGCCGAGCGGCTCCCGCAAGGTGCTCGCCGACGGCACC
TATGCGACAGAGACGGCGCTCACCAGCCAGTCGTCGGCTGCCGCTAGACTGGAAGCCGTCAAGGCCGCTCAGAAG
CCCCCGCTGCGGCAGCTCATTCTCGATGGAGACTACTACCTGGCAACCGTTCTATCGTCGACGTTGGTGAAGCTC
GTCCTGCGGCACTCTGAGGTATCCGCAGACAAGGCGCGCACTAACGCTCTGCGGGCTGAGGCCATGCTCATCATG
ATTTCCATCCTTCGCGTCGGGCAATCCCAGTTTGTCAAGGCGCCGGTAGACGAAGACTCGGTCGATCGCATCATG
TCTTGCGTCCGCTCCTTGGCCGACTTCAAAGAGCGAAAGGAGCTGGAATCAGTTTGGTTGGACGATACGAAAAAA
GCTTTTCGGGCCATGGTCCAGGCCGAAGAGAAGAAGCGGGCGGCCAAGGAGGCGTATGAGAAGGCCAAGGCGGCC
ACGCAAGTCGACGACGTTGTCCAGATCCGGCAGTTGTCCAAGAAGAACCATTCAACGGACCTGGACGAGATCGAG
GTCGACCTGGAGAGGGCGACGGGTGGCGAAGCAACGACGGAGGACCTTTCGTCCAAGCTCAGCCGCGTCTTCCAG
CTGACGGGCTTCTCAGATCCTGTCTACGCTGAGGCGTACGTCAAGGTGCACCAATTCGATATCGTGCTCGACGTG
CTCCTCGTCAACCAGACGACGGAGACGCTACAGAACCTGTCGGTGGAATTCGCGACGCTCGGCGATCTGAAGGTG
GTAGAGCGGCCAACGACACAAAACCTAGGCGCGCACGACTTCCACAACGTCCAGTGCACCATCAAGGTATCGTCG
ACAGACACGGGCGTCATTTTCGGCAATGTCGTTTACGACGGGGCTCACTCGACGGACACAAACGTCGTCATTCTC
AACGACATGCATGTGGACATTATGGATTATATACAGCCGGCTACCTGCACGGAGACGCAATTCCGAACCATGTGG
ACCGAGTTCGAATGGGAGAACAAGGTAAACATCAACTCCAAGGCCAGCTCGCTCCGAGCCTTCCTGGACCAGCTC
AAAGCGTGCACCAACATGAACTGCCTCACGCCCGAGGCCAGCCTGAGGGGAGACTGCCAGTTCCTGAGCGCCAAT
TTGTATGCTCGCACCGTATTCGGCGAGGACGCTCTGGCCAACTTGAGCATCGAGAAGGAGGGTGAAAACGGGCCG
ATCACCGGCTTTGTTAGGATCAGAAGCCGGTCGCAAGGCCTGGCCTTGAGCCTGGGCTCACTGAAGGGACTCAAC
AAGATAGGCACCCCGGCATAA
Gene >Ophun1|6401
ATGTCTGGCTTCCTCGAGAATGCCTACAGCCTGGTGCATCAGGACAATGCCGCCGACGTGCCTACCGTCTCCGAC
CTGCGCCTACAGCTAGAGAAGGGCACCGACGAAGTCAAGGTCGACACCATGAAGCACATCCTGACAATTATGCTC
AATGGAGACCCGATGCCCACCCTACTCATGCACATAATACGATTTGTCATGCCCTCCAAGCACAAGCCTCTCAAA
AAGCTGCTGTACTTTTACTACGAAATCTGCCCCAAGCTTGATGCGGGCGGCAAGCTGAAACAAGAGATGATATTG
GTCTGGTTGGTCTTACCAGCATTCAATTTAATATGCTATCTGGCTTTCTGACTTGAACCAAAAAAAAACCCAGCA
ATGGCATCCGCAACGACCTCCAACATCCCAACGAGTACATACGGGGGAATACGCTGCGATTCCTTTGCAAGCTGC
GTGAGCCGGAATTGATCGAACCTCTCCTCTCATCAGCGCGGCTGTGTCTCGAACACAGGCATGCCTACGTGCGAA
AGAATGCCGTCTTCGCTGTGTCGTGCATACACTCACACTCGCCGTCTCTCATCCCCGATGCCTCCGAGCTCATAT
CGACCTTTCTTGAAGGGGAAACGGACGCTACGTGCAAGAGAAACGCATTCGCGGCACTGGCGAGCATAAACCACG
ACGCCGCGCTTCGCTACCTCAGCTCCGTCTTTGATGGTATACCCAACGCCGCCGATCTTCTGCAGCTGGTGGAGA
TTGAGTTCATCCGCAAGGATGCGGTTCAGAATTCGCAGAATAAGGTGGGAATCACCTGCCCTTGGCCATCAATAA
CTCGCTCCTGACGTCGCAAGGCCCGTTACCTGAGATTGATCTTTGACCTGCTGGATGCTGGAGCGTCCACCGTGG
TGTACGAAGCCGCCTCATCCCTGACAGCTCTTACGAATAATCCGGTCGCCGTCAAGGCAGCGGCCTCCAAGTTTA
TCGAGCTGAGCATCAAGGAGGCGGACAACAACGTCAAGCTCATTGTTCTCGATCGAGTTGACCAGCTGCGGAAAA
AGAATGAGGGCATTCTGGATGACCTGACGATGGAGCTTCTCCGCGTTCTGTCCAGTCCAGACATTGATGTACGCA
GGAAGGCCCTGAGCATCGCGCTGGACATGGTTTCGAGCCGGAATGTCGAAGAGGTCGTCCTCCTCTTCAAGAAAG
AACTGTCCAAGACGGTGGATCAGGAGTACGAGAAGAACGCCGAATACCGGTCTCTCCTGATCCACTCCATCCATC
AGTGCGCCATTAAGTTTTCTGAAATAGCCGCCAGCGTGGTCGAGCTGTTGATGGACTTTATCGCCGATTTCAACA
ACGCGTCAGCCGTCGATGTCATCAACTTCGTCAAAGAGGTCGTTGAGAAGTTTCCGAATCTGCGAAAGACAATCG
TTGAGCGGCTTGTGTTAACGCTCAGCGAAGTCCGCGCGGGAAAAGTTTACCGAGGGATCATGTGGATCATCGGCG
AATACTCGCTGGAAGAGGCGGACATTCGCGACGCATGGAAGCGCATACGGGCCAGTCTCGGCGAGATCCCTATCC
TTGCCTCGGAGCAGCGACTTCTGGAGGAGCATGACGGAGACAAAGGCGACGAGAAGGTCAATGGCAGCTCGAAGC
CGGCGGCGCCGAGCGGCTCCCGCAAGGTGCTCGCCGACGGCACCTATGCGACAGAGACGGCGCTCACCAGCCAGT
CGTCGGCTGCCGCTAGACTGGAAGCCGTCAAGGCCGCTCAGAAGCCCCCGCTGCGGCAGCTCATTCTCGATGGAG
ACTACTACCTGGCAACCGTTCTATCGTCGACGTTGGTGAAGCTCGTCCTGCGGCACTCTGAGGTATCCGCAGACA
AGGCGCGCACTAACGCTCTGCGGGCTGAGGCCATGCTCATCATGATTTCCATCCTTCGCGTCGGGCAATCCCAGT
TTGTCAAGGCGCCGGTAGACGAAGACTCGGTCGATCGCATCATGTCTTGCGTCCGCTCCTTGGCCGACTTCAAAG
AGCGAAAGGAGCTGGAATCAGTTTGGTTGGACGATACGAAAAAAGCTTTTCGGGCCATGGTCCAGGCCGAAGAGA
AGAAGCGGGCGGCCAAGGAGGCGTATGAGAAGGCCAAGGCGGCCACGCAAGTCGACGACGTTGTCCAGATCCGGC
AGTTGTCCAAGAAGAACCATTCAACGGACCTGGACGAGATCGAGGTCGACCTGGAGAGGGCGACGGGTGGCGAAG
CAACGACGGAGGACCTTTCGTCCAAGCTCAGCCGCGTCTTCCAGCTGACGGGCTTCTCAGATCCTGTCTACGCTG
AGGCGTACGTCAAGGTGCACCAATTCGATATCGTGCTCGACGTGCTCCTCGTCAACCAGACGACGGAGACGCTAC
AGAACCTGTCGGTGGAATTCGCGACGCTCGGCGATCTGAAGGTGGTAGAGCGGCCAACGACACAAAACCTAGGCG
CGCACGACTTCCACAACGTCCAGTGCACCATCAAGGTATCGTCGACAGACACGGGCGTCATTTTCGGCAATGTCG
TTTACGACGGGGCTCACTCGACGGACACAAACGTCGTCATTCTCAACGACATGCATGTGGACATTATGGATTATA
TACAGCCGGCTACCTGCACGGAGACGCAATTCCGAACCATGTGGACCGAGTTCGAATGGGAGAACAAGGTAAACA
TCAACTCCAAGGCCAGCTCGCTCCGAGCCTTCCTGGACCAGCTCAAAGCGTGCACCAACATGAACTGCCTCACGC
CCGAGGCCAGCCTGAGGGGAGACTGCCAGTTCCTGAGCGCCAATTTGTATGCTCGCACCGTATTCGGTAAGTAAA
AAACGTGGATCGTACTGCATCTGCCAGTCCATTTCGTCTGACCAGCGCAGGCGAGGACGCTCTGGCCAACTTGAG
CATCGAGAAGGAGGGTGAAAACGGGCCGATCACCGGCTTTGTTAGGATCAGAAGCCGGTCGCAAGGCCTGGCCTT
GAGCCTGGGCTCACTGAAGGGACTCAACAAGATAGGCACCCCGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail