Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6400
Gene name
LocationContig_7:1274..2037
Strand-
Gene length (bp)763
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02792 Mago_nashi Mago nashi protein 2.9E-71 8 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43037|MGN_SCHPO Protein mago nashi homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnh1 PE=3 SV=1 8 154 7.0E-68
sp|P49030|MGN_ORYSJ Protein mago nashi homolog OS=Oryza sativa subsp. japonica GN=Os12g0287200 PE=2 SV=2 8 154 9.0E-67
sp|O23676|MGN_ARATH Protein mago nashi homolog OS=Arabidopsis thaliana GN=At1g02140 PE=1 SV=1 8 154 2.0E-66
sp|Q96A72|MGN2_HUMAN Protein mago nashi homolog 2 OS=Homo sapiens GN=MAGOHB PE=1 SV=1 3 154 2.0E-65
sp|Q0VC92|MGN2_BOVIN Protein mago nashi homolog 2 OS=Bos taurus GN=MAGOHB PE=2 SV=1 8 154 3.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43037|MGN_SCHPO Protein mago nashi homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnh1 PE=3 SV=1 8 154 7.0E-68
sp|P49030|MGN_ORYSJ Protein mago nashi homolog OS=Oryza sativa subsp. japonica GN=Os12g0287200 PE=2 SV=2 8 154 9.0E-67
sp|O23676|MGN_ARATH Protein mago nashi homolog OS=Arabidopsis thaliana GN=At1g02140 PE=1 SV=1 8 154 2.0E-66
sp|Q96A72|MGN2_HUMAN Protein mago nashi homolog 2 OS=Homo sapiens GN=MAGOHB PE=1 SV=1 3 154 2.0E-65
sp|Q0VC92|MGN2_BOVIN Protein mago nashi homolog 2 OS=Bos taurus GN=MAGOHB PE=2 SV=1 8 154 3.0E-65
sp|B9ENE7|MGN_SALSA Protein mago nashi homolog OS=Salmo salar GN=magoh PE=2 SV=1 8 154 3.0E-65
sp|Q566Y8|MGN_DANRE Protein mago nashi homolog OS=Danio rerio GN=magoh PE=2 SV=1 8 154 3.0E-65
sp|P61327|MGN_MOUSE Protein mago nashi homolog OS=Mus musculus GN=Magoh PE=2 SV=1 8 154 4.0E-65
sp|Q9CQL1|MGN2_MOUSE Protein mago nashi homolog 2 OS=Mus musculus GN=Magohb PE=2 SV=1 8 154 4.0E-65
sp|Q3ZBV3|MGN_BOVIN Protein mago nashi homolog OS=Bos taurus GN=MAGOH PE=2 SV=1 8 154 4.0E-65
sp|P61326|MGN_HUMAN Protein mago nashi homolog OS=Homo sapiens GN=MAGOH PE=1 SV=1 8 154 4.0E-65
sp|Q27W02|MGN_RAT Protein mago nashi homolog OS=Rattus norvegicus GN=Magoh PE=2 SV=1 8 154 4.0E-65
sp|P50594|MGN_CHICK Protein mago nashi homolog OS=Gallus gallus GN=MAGOH PE=2 SV=2 8 154 4.0E-65
sp|O65806|MGN_EUPLA Protein mago nashi homolog OS=Euphorbia lagascae PE=2 SV=1 1 154 5.0E-65
sp|O42149|MGN_XENLA Protein mago nashi homolog OS=Xenopus laevis GN=magoh PE=2 SV=1 8 154 7.0E-65
sp|P49028|MGN_DROME Protein mago nashi OS=Drosophila melanogaster GN=mago PE=1 SV=1 6 154 5.0E-64
sp|P49029|MGN_CAEEL Protein mago nashi homolog OS=Caenorhabditis elegans GN=mag-1 PE=1 SV=2 8 154 2.0E-63
sp|Q55E21|MGN_DICDI Protein mago nashi homolog OS=Dictyostelium discoideum GN=magoh PE=3 SV=2 8 154 6.0E-58
[Show less]

GO

GO Term Description Terminal node
GO:0035145 exon-exon junction complex Yes
GO:0008380 RNA splicing Yes
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0005575 cellular_component No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5736
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6503
Ophiocordyceps australis map64 (Brazil) OphauB2|8075
Ophiocordyceps camponoti-floridani Ophcf2|04715
Ophiocordyceps camponoti-rufipedis Ophun1|6400 (this protein)
Ophiocordyceps kimflemingae Ophio5|6179
Ophiocordyceps subramaniannii Hirsu2|9112

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6400
MSATHEPFYLRYYSGHMGRFGHEFLEFDFRVVGDGRSAVTRYANNSNYRNDSLIRKEMCISSVLVDEVKRIIRAS
EIIKEDDSKWPQKNKDGRQELEIRMGTDHISFETAKIGSLVDVTESADPEGMRVFYYLVQDLKALVFSLIALHFK
IKPI*
Coding >Ophun1|6400
ATGTCTGCGACTCACGAGCCTTTTTATCTACGATACTATTCTGGGCACATGGGTCGGTTTGGCCATGAATTTCTC
GAGTTCGATTTCCGAGTCGTCGGCGACGGCCGTAGCGCTGTGACACGATATGCCAATAATTCCAACTATCGAAAT
GACAGCCTCATCAGGAAAGAAATGTGCATCAGCTCGGTGCTTGTGGATGAGGTCAAGCGCATCATCCGGGCGAGC
GAAATCATCAAGGAGGACGACTCCAAGTGGCCACAAAAGAATAAGGATGGACGACAGGAACTCGAAATCCGAATG
GGAACCGATCACATCTCCTTCGAGACGGCTAAGATTGGCTCTTTGGTCGACGTTACGGAATCTGCCGACCCGGAA
GGCATGCGCGTGTTTTACTACCTCGTGCAGGATCTCAAGGCGCTTGTTTTTAGCCTGATTGCTCTGCATTTCAAG
ATAAAGCCCATCTGA
Transcript >Ophun1|6400
ATGTCTGCGACTCACGAGCCTTTTTATCTACGATACTATTCTGGGCACATGGGTCGGTTTGGCCATGAATTTCTC
GAGTTCGATTTCCGAGTCGTCGGCGACGGCCGTAGCGCTGTGACACGATATGCCAATAATTCCAACTATCGAAAT
GACAGCCTCATCAGGAAAGAAATGTGCATCAGCTCGGTGCTTGTGGATGAGGTCAAGCGCATCATCCGGGCGAGC
GAAATCATCAAGGAGGACGACTCCAAGTGGCCACAAAAGAATAAGGATGGACGACAGGAACTCGAAATCCGAATG
GGAACCGATCACATCTCCTTCGAGACGGCTAAGATTGGCTCTTTGGTCGACGTTACGGAATCTGCCGACCCGGAA
GGCATGCGCGTGTTTTACTACCTCGTGCAGGATCTCAAGGCGCTTGTTTTTAGCCTGATTGCTCTGCATTTCAAG
ATAAAGCCCATCTGA
Gene >Ophun1|6400
ATGTCTGCGACTCACGAGCCTTTTTATCTACGATACTAGTGAGTGGCGGCTGACGACAACGGCAGAGCGGGTCAC
TGCAATGCTAACACGACCAAAATAGTTCTGGGCACATGGGTCGGTTTGGCCATGAATTTCTCGGTAAAGCGATCC
TGGCCATTTCATAGCAGGTCTCTGACCCGAGTCTTCGAAGAGTTCGATTTCCGAGTCGTCGGCGACGGCCGTAGC
GCTGTGACACGATATGCCAATAATTCCAACTATCGAAATGACAGCCTCATCAGGAAAGAAAGTACGAATAAGGGC
TCTGAACGCACATGCGATGGCGTGCCGATCTCGCCTACAGACTTGTGAACAATCTTCTAAAACTTCAAATAGTGT
GCATCAGCTCGGTGCTTGTGGATGAGGTCAAGCGCATCATCCGGGCGAGCGAAATCATCAAGTAAATTGAACACG
ATGTTCTAATGCTTGCGACGCTGACATTGTCAAGGGAGGACGACTCCAAGTGGCCACAAAAGAATAAGGATGGAC
GACAGGAACTCGAAATCCGAATGGGAACCGATCACATCTCCTTCGAGGTTCGCCTTCTAACTGGTTGAGATTAGA
ACATGGGTTGACAATCAGACAGACGGCTAAGATTGGCTCTTTGGTCGACGTTACGGAATCTGCCGACCCGGAAGG
CATGCGCGTGTTTTACTACCTCGTGCAGGATCTCAAGGCGCTTGTTTTTAGCCTGATTGCTCTGCATTTCAAGAT
AAAGCCCATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail