Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6380
Gene name
LocationContig_695:1218..2990
Strand-
Gene length (bp)1772
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14604 SH3_9 Variant SH3 domain 1.7E-11 399 445
PF00018 SH3_1 SH3 domain 1.3E-06 396 441

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 209 231 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6380
MVLDGHHRSLHDRRGVYEKMRLRQMEEGQLNDNDVLRLSLSPHGNGPHGHGRRPREAKHAPLQTVVETVYKTLDP
TFSGPIAGYVTLSEGVNKPDASQVADPPASDRKLAHIDSDPSSVIALSTPTSEPPRDDGHSSSSFDSALATPTSA
SVTATTESSLSSLLSPTPSSGSPSISAPTSSPTSGGRAAADFSKGGHGDGHGASVGPKVGIAFGVMGGLAALGLL
IFFVLKRRRKHAEKGYKLDDDDEKSRKGFGISNPFDSSNGDNPGAPRISLRPVTQFLPNWNGLERRTSKGAAGAP
LSSSSLGNQWDRPVNPFDNVPSTIAEEQSIRSFSTTSEGSHGSPHGVFAVAKPNRTSPPPGSVPLATSPTGTEYS
FSSITSEAAANGPRVSIVHRVQLDFKPTLEDEMELCVGELMRLLHEYDDGWCLVSRLNRSHQGVVPRTCLSTRPV
KPRQPPGAPRPGPPVNPTGPGRGPNQGGGLRTQTSGPGGNYRQSPSPQRPGTAQGFRSGPGVVNGAPMNRGPGWQ
QGPTKPLYRTSPTKPTGHGQKPMNT*
Coding >Ophun1|6380
ATGGTGCTTGACGGCCATCATCGGTCTTTGCATGACCGGCGGGGTGTTTACGAGAAGATGAGGTTGAGGCAGATG
GAGGAGGGCCAGTTGAATGACAATGACGTGCTTCGTTTGTCACTGTCGCCGCACGGCAATGGCCCTCATGGTCAT
GGACGTCGACCTCGCGAGGCTAAACATGCGCCCTTGCAGACTGTTGTCGAGACAGTCTACAAAACCCTCGACCCT
ACTTTCTCTGGGCCCATCGCCGGCTACGTGACGCTCAGCGAGGGTGTCAATAAACCAGATGCTTCTCAAGTCGCC
GATCCGCCAGCATCAGACCGCAAACTCGCTCATATAGACAGCGACCCTTCGTCCGTCATCGCTCTATCGACTCCC
ACCTCGGAACCCCCCCGCGACGACGGGCACAGCAGCAGCAGCTTCGACTCGGCACTCGCCACGCCGACTTCCGCG
TCTGTAACGGCCACGACAGAGTCCTCCCTTTCGTCTCTACTCTCGCCCACCCCGTCATCCGGCTCGCCCTCCATC
TCGGCGCCCACCTCGTCGCCCACATCCGGCGGCCGCGCGGCAGCCGACTTCAGCAAAGGCGGCCACGGAGACGGA
CATGGCGCATCCGTGGGGCCCAAGGTCGGCATCGCCTTTGGCGTCATGGGCGGTCTCGCCGCGTTGGGCCTGCTC
ATCTTCTTCGTGCTCAAGCGTCGTCGCAAGCATGCGGAAAAGGGCTACAAGCTCGACGACGACGACGAAAAGTCG
CGCAAAGGCTTTGGCATCTCGAACCCGTTTGACTCGTCCAATGGCGATAATCCCGGTGCGCCTCGCATCAGTCTT
CGACCCGTCACGCAATTCCTACCCAACTGGAACGGACTCGAAAGGCGAACGAGCAAAGGTGCGGCCGGAGCACCG
CTCTCCTCATCATCTCTTGGGAATCAATGGGATCGCCCCGTCAACCCCTTCGACAACGTCCCCTCGACCATTGCC
GAGGAGCAGAGCATCCGCAGCTTCAGCACAACGTCGGAGGGCAGCCACGGGTCGCCTCACGGGGTATTCGCCGTT
GCGAAGCCAAACAGGACGTCGCCACCGCCCGGCAGCGTGCCCCTGGCGACGAGCCCGACGGGGACGGAATATAGC
TTTTCGTCGATTACGTCGGAAGCGGCGGCCAATGGGCCCCGCGTCAGCATCGTTCACCGCGTCCAGCTCGACTTT
AAGCCGACGCTGGAGGATGAGATGGAGTTGTGCGTCGGGGAGCTGATGCGGCTGCTTCACGAGTACGACGACGGA
TGGTGTCTGGTGAGCCGCCTGAACCGATCCCATCAGGGCGTCGTGCCGCGAACCTGCCTCTCAACCCGCCCCGTC
AAGCCGCGCCAACCCCCCGGCGCGCCCCGTCCCGGCCCCCCCGTGAACCCCACGGGCCCCGGCCGGGGACCCAAC
CAGGGAGGCGGCCTCCGGACTCAGACGTCGGGTCCCGGCGGCAACTACAGACAGTCCCCTTCTCCGCAGCGGCCC
GGCACGGCGCAGGGTTTCCGAAGCGGGCCTGGCGTCGTCAACGGAGCGCCGATGAATCGTGGGCCGGGGTGGCAG
CAGGGACCGACGAAGCCCCTGTACCGGACGTCGCCCACCAAGCCGACAGGCCATGGGCAGAAGCCGATGAATACA
TGA
Transcript >Ophun1|6380
ATGGTGCTTGACGGCCATCATCGGTCTTTGCATGACCGGCGGGGTGTTTACGAGAAGATGAGGTTGAGGCAGATG
GAGGAGGGCCAGTTGAATGACAATGACGTGCTTCGTTTGTCACTGTCGCCGCACGGCAATGGCCCTCATGGTCAT
GGACGTCGACCTCGCGAGGCTAAACATGCGCCCTTGCAGACTGTTGTCGAGACAGTCTACAAAACCCTCGACCCT
ACTTTCTCTGGGCCCATCGCCGGCTACGTGACGCTCAGCGAGGGTGTCAATAAACCAGATGCTTCTCAAGTCGCC
GATCCGCCAGCATCAGACCGCAAACTCGCTCATATAGACAGCGACCCTTCGTCCGTCATCGCTCTATCGACTCCC
ACCTCGGAACCCCCCCGCGACGACGGGCACAGCAGCAGCAGCTTCGACTCGGCACTCGCCACGCCGACTTCCGCG
TCTGTAACGGCCACGACAGAGTCCTCCCTTTCGTCTCTACTCTCGCCCACCCCGTCATCCGGCTCGCCCTCCATC
TCGGCGCCCACCTCGTCGCCCACATCCGGCGGCCGCGCGGCAGCCGACTTCAGCAAAGGCGGCCACGGAGACGGA
CATGGCGCATCCGTGGGGCCCAAGGTCGGCATCGCCTTTGGCGTCATGGGCGGTCTCGCCGCGTTGGGCCTGCTC
ATCTTCTTCGTGCTCAAGCGTCGTCGCAAGCATGCGGAAAAGGGCTACAAGCTCGACGACGACGACGAAAAGTCG
CGCAAAGGCTTTGGCATCTCGAACCCGTTTGACTCGTCCAATGGCGATAATCCCGGTGCGCCTCGCATCAGTCTT
CGACCCGTCACGCAATTCCTACCCAACTGGAACGGACTCGAAAGGCGAACGAGCAAAGGTGCGGCCGGAGCACCG
CTCTCCTCATCATCTCTTGGGAATCAATGGGATCGCCCCGTCAACCCCTTCGACAACGTCCCCTCGACCATTGCC
GAGGAGCAGAGCATCCGCAGCTTCAGCACAACGTCGGAGGGCAGCCACGGGTCGCCTCACGGGGTATTCGCCGTT
GCGAAGCCAAACAGGACGTCGCCACCGCCCGGCAGCGTGCCCCTGGCGACGAGCCCGACGGGGACGGAATATAGC
TTTTCGTCGATTACGTCGGAAGCGGCGGCCAATGGGCCCCGCGTCAGCATCGTTCACCGCGTCCAGCTCGACTTT
AAGCCGACGCTGGAGGATGAGATGGAGTTGTGCGTCGGGGAGCTGATGCGGCTGCTTCACGAGTACGACGACGGA
TGGTGTCTGGTGAGCCGCCTGAACCGATCCCATCAGGGCGTCGTGCCGCGAACCTGCCTCTCAACCCGCCCCGTC
AAGCCGCGCCAACCCCCCGGCGCGCCCCGTCCCGGCCCCCCCGTGAACCCCACGGGCCCCGGCCGGGGACCCAAC
CAGGGAGGCGGCCTCCGGACTCAGACGTCGGGTCCCGGCGGCAACTACAGACAGTCCCCTTCTCCGCAGCGGCCC
GGCACGGCGCAGGGTTTCCGAAGCGGGCCTGGCGTCGTCAACGGAGCGCCGATGAATCGTGGGCCGGGGTGGCAG
CAGGGACCGACGAAGCCCCTGTACCGGACGTCGCCCACCAAGCCGACAGGCCATGGGCAGAAGCCGATGAATACA
TGA
Gene >Ophun1|6380
ATGGTGCTTGACGGCCATCATCGGTCTTTGCATGACCGGCGGGGTGTTTACGAGAAGATGAGGTTGAGGCAGATG
GAGGAGGGCCAGTTGAATGACAATGACGTGCTTCGTTTGTCACTGTCGCCGCACGGCAATGGCCCTCATGGTCAT
GGACGTCGACCTCGCGAGGCTAAACATGGTATTATCATCTCTCTCCCCTTCTCCCTCCTCTTCTCCCTCCTCCCG
TGGCTAACGCGTCGGCAGCGCCCTTGCAGACTGTTGTCGAGACAGTCTACAAAACCCTCGACCCTACTTTCTCTG
GGCCCATCGCCGGCTACGTGACGCTCAGCGAGGGTGTCAATAAACCAGATGCTTCTCAAGTCGCCGATCCGCCAG
CATCAGACCGCAAACTCGCTCATATAGACAGCGACCCTTCGTCCGTCATCGCTCTATCGACTCCCACCTCGGAAC
CCCCCCGCGACGACGGGCACAGCAGCAGCAGCTTCGACTCGGCACTCGCCACGCCGACTTCCGCGTCTGTAACGG
CCACGACAGAGTCCTCCCTTTCGTCTCTACTCTCGCCCACCCCGTCATCCGGCTCGCCCTCCATCTCGGCGCCCA
CCTCGTCGCCCACATCCGGCGGCCGCGCGGCAGCCGACTTCAGCAAAGGCGGCCACGGAGACGGACATGGCGCAT
CCGTGGGGCCCAAGGTCGGCATCGCCTTTGGCGTCATGGGCGGTCTCGCCGCGTTGGGCCTGCTCATCTTCTTCG
TGCTCAAGCGTCGTCGCAAGCATGCGGAAAAGGGCTACAAGCTCGACGACGACGACGAAAAGTCGCGCAAAGGCT
TTGGCATCTCGAACCCGTTTGACTCGTCCAATGGCGATAATCCCGGTGCGCCTCGCATCAGTCTTCGACCCGTCA
CGCAATTCCTACCCAACTGGAACGGACTCGAAAGGCGAACGAGCAAAGGTGCGGCCGGAGCACCGCTCTCCTCAT
CATCTCTTGGGAATCAATGGGATCGCCCCGTCAACCCCTTCGACAACGTCCCCTCGACCATTGCCGAGGAGCAGA
GCATCCGCAGCTTCAGCACAACGTCGGAGGGCAGCCACGGGTCGCCTCACGGGGTATTCGCCGTTGCGAAGCCAA
ACAGGACGTCGCCACCGCCCGGCAGCGTGCCCCTGGCGACGAGCCCGACGGGGACGGAATATAGCTTTTCGTCGA
TTACGTCGGAAGCGGCGGCCAATGGGCCCCGCGTCAGCATCGTTCACCGCGTCCAGCTCGACTTTAAGCCGACGC
TGGAGGATGAGATGGAGTTGTGCGTCGGGGAGCTGATGCGGCTGCTTCACGAGTACGACGACGGATGGGTAAGCT
CGTCGTCCCCCTTCTCATGTCCGTCGAGGCTGCTAAACGCAAGACAGTGTCTGGTGAGCCGCCTGAACCGATCCC
ATCAGGGCGTCGTGCCGCGAACCTGCCTCTCAACCCGCCCCGTCAAGCCGCGCCAACCCCCCGGCGCGCCCCGTC
CCGGCCCCCCCGTGAACCCCACGGGCCCCGGCCGGGGACCCAACCAGGGAGGCGGCCTCCGGACTCAGACGTCGG
GTCCCGGCGGCAACTACAGACAGTCCCCTTCTCCGCAGCGGCCCGGCACGGCGCAGGGTTTCCGAAGCGGGCCTG
GCGTCGTCAACGGAGCGCCGATGAATCGTGGGCCGGGGTGGCAGCAGGGACCGACGAAGCCCCTGTACCGGACGT
CGCCCACCAAGCCGACAGGCCATGGGCAGAAGCCGATGAATACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail