Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6379
Gene name
LocationContig_694:5909..7909
Strand-
Gene length (bp)2000
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3726
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1631
Ophiocordyceps australis map64 (Brazil) OphauB2|5834
Ophiocordyceps camponoti-floridani Ophcf2|04851
Ophiocordyceps camponoti-rufipedis Ophun1|6379 (this protein)
Ophiocordyceps kimflemingae Ophio5|5509
Ophiocordyceps subramaniannii Hirsu2|7271

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6379
MASMSPIDTSAAAISGPSSNAGSVSPRQTATPKNVAFELMFSNSPQYRARLPMRVQIYPHDTTDSIVTTVKNFYG
LYSGPSGSKGVSFEDDNGNTLIARYENFANNMIVYVRVIEEPPPAFAPQPFQAAPAVGPEPYFAADAFPAQQPQQ
RFDHDILRPGSRASRRRSTSPSAARRRRSVSPSTSCKKGRSRSFKKRGSVAGGHADACSDSINGYSSGDGAPSTV
SAKTKEHLGNTDISVDNIVEGGRRKRAKFESSELPLFAPPQMPAATSNPSVSPARRVEHQRPSMPFVHPGQSPFT
NPRPMQSPQSYGGGVVHAAMYATPVSQGHRSRGSMGYPSSGATGLGVLPTPDPTVGSCMSEEDKDVAIQLMRLGE
SSNISHGRTSASTMDDTFSGRADVASSTGATSDGSDSERDGPAPRRQKLDASGGSRPIYETTESHFLPTTEGGDV
SADEADDDGANSSVGDGKMVPHAKPAAAKKQSSAKPKTAPKLAKSKAARPSSSKAKKQPVAAPPAGPMSPTSLTH
SRKQSVASIGLAAQPGEDEQPDLSTKPRCQRCRKSKKGCDRQRPCGRCRDAGLSADQCISEDEGNGRKGRYGRHM
GVPIKQEDASMAATPGLLPAAPITAAVGAADKVKKRKR*
Coding >Ophun1|6379
ATGGCCTCCATGTCGCCCATAGACACCTCGGCCGCCGCCATCTCGGGGCCCTCGTCCAACGCCGGCAGCGTCTCT
CCGCGACAGACGGCCACTCCCAAGAACGTCGCATTCGAGTTGATGTTCTCCAACTCGCCGCAGTATCGCGCGCGT
CTCCCCATGCGGGTCCAGATCTATCCTCATGATACCACCGATTCCATCGTCACCACCGTCAAGAATTTCTACGGC
CTCTACTCTGGTCCGTCCGGCTCAAAGGGCGTCAGCTTCGAGGACGACAACGGCAACACGCTCATTGCGCGCTAC
GAGAACTTCGCCAACAACATGATCGTCTACGTCCGCGTAATAGAGGAGCCTCCCCCGGCCTTTGCGCCGCAACCG
TTCCAAGCCGCGCCCGCCGTCGGCCCCGAACCATACTTCGCCGCCGACGCCTTCCCGGCCCAACAGCCCCAGCAG
CGTTTCGACCACGACATTCTCCGGCCCGGCTCCCGAGCATCGCGTCGTCGCAGTACCTCGCCCAGCGCCGCCCGC
CGTCGCCGGAGCGTCTCGCCGAGCACCTCTTGCAAGAAGGGGCGCTCTCGGTCGTTCAAGAAGCGAGGGTCCGTG
GCTGGCGGCCATGCTGACGCATGCAGCGACAGCATCAACGGCTACAGCAGCGGCGACGGCGCCCCCAGCACCGTC
TCTGCCAAGACCAAGGAGCACCTGGGCAACACCGACATCAGCGTCGATAACATTGTCGAAGGAGGCCGGCGCAAG
AGGGCCAAGTTTGAGAGCTCGGAGCTGCCCCTGTTTGCGCCGCCGCAGATGCCGGCTGCCACGTCCAACCCGTCG
GTGTCTCCGGCCCGCCGCGTCGAGCACCAGCGGCCGTCGATGCCGTTTGTCCACCCGGGCCAGAGCCCCTTTACA
AACCCGCGGCCCATGCAGTCGCCGCAGAGCTACGGCGGCGGCGTCGTCCACGCCGCCATGTACGCCACTCCCGTC
AGCCAGGGTCACCGCTCGCGCGGCAGCATGGGCTACCCCAGCAGCGGCGCCACCGGCCTTGGCGTCCTGCCCACG
CCGGATCCCACCGTCGGCAGCTGCATGTCGGAAGAGGACAAGGACGTCGCCATTCAGCTCATGAGGCTCGGTGAG
TCGTCCAACATCTCGCACGGCCGTACCTCGGCCTCTACCATGGACGACACCTTCAGCGGCCGGGCCGACGTCGCT
TCCTCTACCGGCGCCACCAGTGATGGCAGTGACAGTGAGCGCGACGGACCCGCGCCTCGTCGTCAGAAGCTTGAC
GCGTCCGGCGGTTCGCGGCCCATCTATGAGACGACCGAGTCGCACTTTCTGCCCACGACCGAGGGAGGCGACGTC
AGCGCTGACGAAGCCGACGACGACGGCGCAAACAGCTCGGTAGGAGACGGCAAGATGGTTCCCCACGCCAAGCCT
GCCGCCGCCAAGAAGCAATCGTCGGCCAAGCCCAAGACGGCGCCTAAGCTCGCCAAGTCCAAGGCCGCCCGACCT
TCCAGTTCCAAGGCCAAGAAGCAGCCTGTCGCGGCGCCGCCGGCCGGGCCCATGTCGCCGACGTCCCTCACGCAC
TCGCGAAAGCAGTCTGTGGCCTCGATCGGGCTGGCGGCTCAGCCCGGCGAGGACGAGCAGCCGGACCTTTCGACC
AAGCCCCGGTGCCAGCGATGCCGCAAGAGCAAAAAGGGCTGTGACCGTCAGCGCCCCTGCGGACGTTGCCGCGAC
GCGGGACTCTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGACGCAAGGGACGATATGGTCGCCACATG
GGCGTCCCCATCAAGCAAGAAGATGCCTCGATGGCCGCCACGCCCGGTCTGCTACCCGCCGCTCCCATCACTGCC
GCCGTGGGAGCCGCGGACAAGGTGAAGAAGCGCAAGCGGTAG
Transcript >Ophun1|6379
ATGGCCTCCATGTCGCCCATAGACACCTCGGCCGCCGCCATCTCGGGGCCCTCGTCCAACGCCGGCAGCGTCTCT
CCGCGACAGACGGCCACTCCCAAGAACGTCGCATTCGAGTTGATGTTCTCCAACTCGCCGCAGTATCGCGCGCGT
CTCCCCATGCGGGTCCAGATCTATCCTCATGATACCACCGATTCCATCGTCACCACCGTCAAGAATTTCTACGGC
CTCTACTCTGGTCCGTCCGGCTCAAAGGGCGTCAGCTTCGAGGACGACAACGGCAACACGCTCATTGCGCGCTAC
GAGAACTTCGCCAACAACATGATCGTCTACGTCCGCGTAATAGAGGAGCCTCCCCCGGCCTTTGCGCCGCAACCG
TTCCAAGCCGCGCCCGCCGTCGGCCCCGAACCATACTTCGCCGCCGACGCCTTCCCGGCCCAACAGCCCCAGCAG
CGTTTCGACCACGACATTCTCCGGCCCGGCTCCCGAGCATCGCGTCGTCGCAGTACCTCGCCCAGCGCCGCCCGC
CGTCGCCGGAGCGTCTCGCCGAGCACCTCTTGCAAGAAGGGGCGCTCTCGGTCGTTCAAGAAGCGAGGGTCCGTG
GCTGGCGGCCATGCTGACGCATGCAGCGACAGCATCAACGGCTACAGCAGCGGCGACGGCGCCCCCAGCACCGTC
TCTGCCAAGACCAAGGAGCACCTGGGCAACACCGACATCAGCGTCGATAACATTGTCGAAGGAGGCCGGCGCAAG
AGGGCCAAGTTTGAGAGCTCGGAGCTGCCCCTGTTTGCGCCGCCGCAGATGCCGGCTGCCACGTCCAACCCGTCG
GTGTCTCCGGCCCGCCGCGTCGAGCACCAGCGGCCGTCGATGCCGTTTGTCCACCCGGGCCAGAGCCCCTTTACA
AACCCGCGGCCCATGCAGTCGCCGCAGAGCTACGGCGGCGGCGTCGTCCACGCCGCCATGTACGCCACTCCCGTC
AGCCAGGGTCACCGCTCGCGCGGCAGCATGGGCTACCCCAGCAGCGGCGCCACCGGCCTTGGCGTCCTGCCCACG
CCGGATCCCACCGTCGGCAGCTGCATGTCGGAAGAGGACAAGGACGTCGCCATTCAGCTCATGAGGCTCGGTGAG
TCGTCCAACATCTCGCACGGCCGTACCTCGGCCTCTACCATGGACGACACCTTCAGCGGCCGGGCCGACGTCGCT
TCCTCTACCGGCGCCACCAGTGATGGCAGTGACAGTGAGCGCGACGGACCCGCGCCTCGTCGTCAGAAGCTTGAC
GCGTCCGGCGGTTCGCGGCCCATCTATGAGACGACCGAGTCGCACTTTCTGCCCACGACCGAGGGAGGCGACGTC
AGCGCTGACGAAGCCGACGACGACGGCGCAAACAGCTCGGTAGGAGACGGCAAGATGGTTCCCCACGCCAAGCCT
GCCGCCGCCAAGAAGCAATCGTCGGCCAAGCCCAAGACGGCGCCTAAGCTCGCCAAGTCCAAGGCCGCCCGACCT
TCCAGTTCCAAGGCCAAGAAGCAGCCTGTCGCGGCGCCGCCGGCCGGGCCCATGTCGCCGACGTCCCTCACGCAC
TCGCGAAAGCAGTCTGTGGCCTCGATCGGGCTGGCGGCTCAGCCCGGCGAGGACGAGCAGCCGGACCTTTCGACC
AAGCCCCGGTGCCAGCGATGCCGCAAGAGCAAAAAGGGCTGTGACCGTCAGCGCCCCTGCGGACGTTGCCGCGAC
GCGGGACTCTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGACGCAAGGGACGATATGGTCGCCACATG
GGCGTCCCCATCAAGCAAGAAGATGCCTCGATGGCCGCCACGCCCGGTCTGCTACCCGCCGCTCCCATCACTGCC
GCCGTGGGAGCCGCGGACAAGGTGAAGAAGCGCAAGCGGTAG
Gene >Ophun1|6379
ATGGCCTCCATGTCGCCCATAGACACCTCGGCCGCCGCCATCTCGGGGCCCTCGTCCAACGCCGGCAGCGTCTCT
CCGCGACAGACGGCCACTCCCAAGAACGTCGCATTCGAGTTGATGTTCTCCAACTCGCCGCAGTATCGCGCGCGT
CTCCCCATGCGGGTCCAGATCTATCCTCATGATACCACCGATTCCATCGTCACCACCGTCAAGAATTTCTACGGC
CTCTACTCTGGTCCGTCCGGCTCAAAGGGCGTCAGCTTCGAGGACGACAACGGCAACACGCTCATTGCGCGCTAC
GAGAACTTCGCCAACAACATGATCGTCTACGTCCGCGTAATAGAGGAGCCTCCCCCGGCCTTTGCGCCGCAACCG
TTCCAAGCCGCGCCCGCCGTCGGCCCCGAACCATACTTCGCCGCCGACGCCTTCCCGGCCCAACAGCCCCAGCAG
CGTTTCGACCACGACATTCTCCGGCCCGGCTCCCGAGCATCGCGTCGTCGCAGTACCTCGCCCAGCGCCGCCCGC
CGTCGCCGGAGCGTCTCGCCGAGCACCTCTTGCAAGAAGGGGCGCTCTCGGTCGTTCAAGAAGCGAGGGTCCGTG
GCTGGCGGCCATGCTGACGCATGCAGCGACAGCATCAACGGCTACAGCAGCGGCGACGGCGCCCCCAGCACCGTC
TCTGCCAAGACCAAGGAGCACCTGGGCAACACCGACATCAGCGTCGATAACATTGTCGAAGGAGGCCGGCGCAAG
AGGGCCAAGTTTGAGAGCTCGGTAGGCATCTCCCGTCTCGCTCCCTTACGCAGCAGCAGCACCGTCTTGCATGTC
CTCTTCCGCACACTGACGGTCCGCTCAAGGAGCTGCCCCTGTTTGCGCCGCCGCAGATGCCGGCTGCCACGTCCA
ACCCGTCGGTGTCTCCGGCCCGCCGCGTCGAGCACCAGCGGCCGTCGATGCCGTTTGTCCACCCGGGCCAGAGCC
CCTTTACAAACCCGCGGCCCATGCAGTCGCCGCAGAGCTACGGCGGCGGCGTCGTCCACGCCGCCATGTACGCCA
CTCCCGTCAGCCAGGGTCACCGCTCGCGCGGCAGCATGGGCTACCCCAGCAGCGGCGCCACCGGCCTTGGCGTCC
TGCCCACGCCGGATCCCACCGTCGGCAGCTGCATGTCGGAAGAGGACAAGGACGTCGCCATTCAGCTCATGAGGC
TCGGTGAGTCGTCCAACATCTCGCACGGCCGTACCTCGGCCTCTACCATGGACGACACCTTCAGCGGCCGGGCCG
ACGTCGCTTCCTCTACCGGCGCCACCAGTGATGGCAGTGACAGTGAGCGCGACGGACCCGCGCCTCGTCGTCAGA
AGCTTGACGCGTCCGGCGGTTCGCGGCCCATCTATGAGACGACCGAGTCGCACTTTCTGCCCACGACCGAGGGAG
GCGACGTCAGCGCTGACGAAGCCGACGACGACGGCGCAAACAGCTCGGTAGGAGACGGCAAGATGGTTCCCCACG
CCAAGCCTGCCGCCGCCAAGAAGCAATCGTCGGCCAAGCCCAAGACGGCGCCTAAGCTCGCCAAGTCCAAGGCCG
CCCGACCTTCCAGTTCCAAGGCCAAGAAGCAGCCTGTCGCGGCGCCGCCGGCCGGGCCCATGTCGCCGACGTCCC
TCACGCACTCGCGAAAGCAGTCTGTGGCCTCGATCGGGCTGGCGGCTCAGCCCGGCGAGGACGAGCAGCCGGACC
TTTCGACCAAGCCCCGGTGCCAGCGATGCCGCAAGAGCAAAAAGGGCTGTGACCGTCAGCGCCCCTGCGGACGTT
GCCGCGACGCGGGACTCTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGACGCAAGGGACGATATGGTC
GCCACATGGGCGTCCCCATCAAGCAAGAAGATGCCTCGATGGCCGCCACGCCCGGTCTGCTACCCGCCGCTCCCA
TCACTGCCGCCGTGGGAGCCGCGGACAAGGTGAAGAAGCGCAAGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail