Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6363
Gene name
LocationContig_69:28176..32450
Strand-
Gene length (bp)4274
Transcript length (bp)3741
Coding sequence length (bp)3741
Protein length (aa) 1247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10156 Med17 Subunit 17 of Mediator complex 9.1E-85 627 1024
PF01565 FAD_binding_4 FAD binding domain 2.6E-20 115 261
PF08031 BBE Berberine and berberine like 2.6E-11 523 565

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B8A6|MED17_EMENI Mediator of RNA polymerase II transcription subunit 17 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=srb4 PE=3 SV=1 617 1060 1.0E-70
sp|A1CV59|MED17_NEOFI Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=srb4 PE=3 SV=1 617 1108 3.0E-70
sp|Q4W9B7|MED17_ASPFU Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=srb4 PE=3 SV=1 617 1110 4.0E-67
sp|Q2UJ16|MED17_ASPOR Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=srb4 PE=3 SV=1 617 1129 4.0E-67
sp|Q1DLD2|MED17_COCIM Mediator of RNA polymerase II transcription subunit 17 OS=Coccidioides immitis (strain RS) GN=SRB4 PE=3 SV=1 617 1098 8.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B8A6|MED17_EMENI Mediator of RNA polymerase II transcription subunit 17 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=srb4 PE=3 SV=1 617 1060 1.0E-70
sp|A1CV59|MED17_NEOFI Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=srb4 PE=3 SV=1 617 1108 3.0E-70
sp|Q4W9B7|MED17_ASPFU Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=srb4 PE=3 SV=1 617 1110 4.0E-67
sp|Q2UJ16|MED17_ASPOR Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=srb4 PE=3 SV=1 617 1129 4.0E-67
sp|Q1DLD2|MED17_COCIM Mediator of RNA polymerase II transcription subunit 17 OS=Coccidioides immitis (strain RS) GN=SRB4 PE=3 SV=1 617 1098 8.0E-66
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 28 571 1.0E-65
sp|Q0CG59|MED17_ASPTN Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=srb4 PE=3 SV=1 617 1120 2.0E-65
sp|A1CLT5|MED17_ASPCL Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=srb4 PE=3 SV=1 617 1129 9.0E-65
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 23 560 3.0E-60
sp|Q6C022|MED17_YARLI Mediator of RNA polymerase II transcription subunit 17 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB4 PE=3 SV=1 631 987 3.0E-25
sp|Q5AHZ7|MED17_CANAL Mediator of RNA polymerase II transcription subunit 17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB4 PE=3 SV=2 624 920 6.0E-23
sp|A3LRF0|MED17_PICST Mediator of RNA polymerase II transcription subunit 17 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SRB4 PE=3 SV=3 624 920 9.0E-20
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 115 329 6.0E-18
sp|Q6CR96|MED17_KLULA Mediator of RNA polymerase II transcription subunit 17 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SRB4 PE=3 SV=1 694 1025 3.0E-11
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 239 567 3.0E-09
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 115 567 4.0E-09
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 115 567 1.0E-08
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 239 567 2.0E-08
sp|Q6FQ87|MED17_CANGA Mediator of RNA polymerase II transcription subunit 17 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SRB4 PE=3 SV=1 677 1010 4.0E-08
sp|P87306|MED17_SCHPO Mediator of RNA polymerase II transcription subunit 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med17 PE=1 SV=1 617 941 6.0E-08
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 114 301 1.0E-07
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 99 319 1.0E-07
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 115 302 7.0E-07
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 115 567 8.0E-07
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 123 324 1.0E-06
sp|Q75D58|MED17_ASHGO Mediator of RNA polymerase II transcription subunit 17 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SRB4 PE=3 SV=1 570 845 2.0E-06
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 118 289 3.0E-06
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 114 567 3.0E-06
sp|Q6FS20|ALO_CANGA D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALO1 PE=3 SV=1 115 300 4.0E-06
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 140 294 6.0E-06
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 111 302 8.0E-06
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 118 289 8.0E-06
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 118 289 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003712 transcription coregulator activity Yes
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0051252 regulation of RNA metabolic process No
GO:0043167 ion binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0140513 nuclear protein-containing complex No
GO:0010468 regulation of gene expression No
GO:0032991 protein-containing complex No
GO:0097159 organic cyclic compound binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0008150 biological_process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0050789 regulation of biological process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0000166 nucleotide binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0031323 regulation of cellular metabolic process No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0006355 regulation of transcription, DNA-templated No
GO:0019219 regulation of nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6363
MRPYLSLYLLSSITAADCSTTNCKSFHGSRDWPSHSVWASLNGTLGGRLLAPLPPGAVCHAEQPSYNASACPERK
KEWSRYEWHAEDPLSVMWDQFTHYSCLPDANAPCTARGYPTYVVNASTAEHVKTGIDFARNHNIRLVVKNSGHDF
IGRSVAPGALSIWAHNLNTIKFNPEEFKLDGSSRVIKTNSMTIGGGVQMYDAYKAADQHGQTITGGGGKSVAFGG
YVSGGGHSFVAPYFGLAADNILQMEVVTPAGDIMTVNEDQYPEIFWALRGGGGSTFGVITSLTIKSYPKARVSYT
SYKIVADPQAPFLWDMITYVISQLPYLMDSGFAGKNFVNHSMPNPDPSSGLPSKVAGVSGQNLLLNASEPNIAAK
IFKPINDTLQSRWPGKVLLHLETQHYPTSLAWFEKNYDASTGGYSRYLVSRLLDKQSLTGNETALRDALKAANEP
NGLLAFFTVAGKGVQNAKPRGGDAVHPAWRQAYVHSVATAEFPPFNKTAEREAIAILDRSFQPLRDLTPNSGAYM
NEALPFEKDWQHTFWGSNYERLLAIKKNVDPTDVFCYTASCPGMTIGDSIGDSKHHHQASANPIPRRQPTHEALH
CPAPATATMSAAEATFLSLRPVPIADKEPKNLAEFISRVNAQPGGFRDVTESALREAIETNGDASVEDVVMVDAV
EEEDAAAPSKDAASARLEVLKGVDIAGNTAMLILDSLSLLLSKQSPTSASLTLSQQLRDMVGIGTLSVDRLDEPT
AREERVKDGEQVATGWTLMEINKTRDAAVSAAALLDKEVAIESRYWDDVMAVKKAGWSMCRVPNERHTLGVRFGF
SETSTEFKNNGLAPMRRGEDGSVELDVGRLGGVSECLVVSYVRNDRVVGRSRPHRRQRNATSLESRVLEARNTIF
SQELWHELIKEARTLAAYDVRLQGSQLRCRVDDETALTMELLELSSCPAPDDSLPYNDMAEAVSLGLHMLLSYAH
RHNELMRTRPMPPHMSRSRPTNQTYALLRPIIARLVSDASIEACTRLVGSLSRALTKAGLASSFTLRPSSSPTTD
PSSSSPSSHASPSQTLIRNMLQPRDLAIDFSILPDISLSIRLRTFLFPVTSSHFNVSLPPDSPLRPSSAPYQDGY
PDVRALADYLDTTVSRCLTRHFLSRLPPDDANGNTRRWTETIVGTSIRDPDSDRWSLRFSTVRNDADPIPSAALI
LASSVVGPDGDPPRRRSWKWSSGENPEDEPRSMADVVAEVARMTPS*
Coding >Ophun1|6363
ATGAGACCCTACCTGTCGCTGTACCTCCTCTCGAGCATCACCGCCGCAGACTGCAGCACCACAAACTGCAAGTCC
TTTCATGGATCTCGCGATTGGCCTTCTCATAGTGTCTGGGCGAGCCTCAATGGCACGCTAGGCGGGCGTCTCCTC
GCACCGCTCCCCCCTGGCGCAGTCTGTCACGCCGAGCAGCCGTCATACAACGCCAGTGCATGTCCCGAACGCAAG
AAAGAATGGTCCCGTTACGAGTGGCACGCAGAGGATCCCCTCTCTGTTATGTGGGATCAGTTTACGCACTATAGC
TGTCTGCCTGATGCCAACGCCCCCTGCACCGCTCGGGGCTATCCCACGTACGTCGTCAATGCATCTACCGCAGAG
CACGTCAAGACTGGTATCGACTTTGCCAGAAATCACAACATCAGGCTCGTCGTCAAGAACAGCGGACACGACTTC
ATCGGCCGATCTGTTGCTCCTGGAGCACTCTCTATCTGGGCCCATAATCTAAACACCATCAAGTTCAACCCGGAA
GAGTTCAAGCTCGATGGCTCCAGCCGAGTTATCAAGACCAACTCCATGACTATCGGCGGCGGAGTTCAAATGTAC
GATGCTTACAAGGCGGCTGATCAGCACGGACAGACCATTACCGGCGGCGGAGGAAAGTCGGTTGCCTTTGGCGGC
TACGTCTCTGGCGGCGGGCATTCGTTTGTTGCGCCGTACTTTGGCTTGGCTGCTGATAACATTTTGCAAATGGAG
GTTGTTACTCCAGCTGGGGATATCATGACCGTCAACGAGGATCAATACCCGGAAATCTTCTGGGCCTTGAGAGGC
GGCGGAGGCTCAACCTTTGGCGTCATCACCAGCCTGACCATCAAATCCTACCCCAAGGCAAGAGTCAGCTATACT
AGCTACAAGATCGTCGCCGATCCTCAAGCACCTTTTCTGTGGGACATGATCACCTATGTCATCTCACAGCTGCCC
TATCTTATGGACTCTGGGTTCGCCGGCAAAAACTTTGTGAACCACAGCATGCCGAACCCTGACCCATCGTCCGGC
TTGCCCAGCAAGGTGGCAGGAGTATCGGGCCAGAACCTTTTGCTGAATGCTAGCGAGCCCAATATTGCGGCGAAG
ATCTTTAAGCCCATCAACGATACCCTGCAGTCGAGATGGCCCGGAAAGGTTCTGCTGCATCTAGAAACACAACAC
TATCCAACCTCCTTGGCCTGGTTCGAAAAGAACTACGATGCTAGCACTGGCGGCTACTCGCGCTACCTCGTATCG
CGGCTATTGGACAAGCAGTCACTGACAGGCAACGAAACGGCGCTACGAGATGCACTGAAAGCAGCCAACGAGCCC
AACGGCCTCTTAGCCTTCTTCACAGTTGCTGGAAAGGGAGTTCAGAATGCGAAGCCGCGGGGAGGAGACGCTGTT
CATCCAGCCTGGCGCCAGGCCTATGTTCACTCTGTTGCCACGGCTGAGTTTCCGCCGTTCAACAAGACGGCCGAG
AGGGAGGCGATTGCGATACTTGACCGATCTTTCCAGCCTTTGCGAGATCTGACGCCAAATTCGGGAGCTTATATG
AACGAGGCGCTTCCGTTTGAGAAAGACTGGCAGCATACCTTCTGGGGGAGCAACTACGAGAGACTGCTGGCGATC
AAGAAGAATGTCGATCCGACTGATGTGTTTTGCTACACAGCCTCATGCCCGGGCATGACCATCGGAGACTCCATC
GGAGACTCCAAGCATCACCACCAAGCATCAGCAAACCCCATCCCCCGTCGACAGCCCACGCATGAAGCTCTCCAC
TGCCCGGCTCCAGCCACAGCCACCATGTCGGCAGCTGAAGCCACCTTCCTCTCGCTGAGGCCGGTGCCCATCGCC
GACAAGGAGCCCAAGAACCTGGCGGAATTCATCTCGCGTGTCAATGCTCAGCCTGGCGGTTTTCGCGATGTCACC
GAGTCAGCTCTTCGAGAAGCCATCGAGACGAACGGAGACGCTTCTGTCGAGGATGTCGTCATGGTCGATGCTGTT
GAGGAGGAAGATGCTGCAGCTCCGTCGAAAGACGCCGCTTCAGCTCGTCTGGAGGTGCTCAAGGGCGTAGACATC
GCCGGAAACACAGCCATGCTCATCCTCGACTCCCTCTCTCTCCTCCTCTCGAAGCAAAGCCCGACCTCGGCTAGC
CTGACGCTCTCACAACAGCTCCGCGACATGGTAGGCATCGGCACCCTCAGCGTCGACCGCCTCGACGAACCGACA
GCCCGCGAAGAGCGCGTCAAGGACGGCGAGCAGGTCGCAACGGGCTGGACCCTAATGGAAATCAACAAGACGCGT
GACGCCGCCGTCTCAGCCGCCGCCTTGCTGGACAAGGAGGTGGCCATCGAGAGCAGATACTGGGACGACGTCATG
GCGGTTAAGAAGGCCGGCTGGTCCATGTGCCGCGTCCCCAACGAGAGACACACGCTCGGCGTCCGCTTCGGCTTC
TCCGAGACGTCGACCGAGTTCAAGAATAACGGGCTGGCGCCGATGCGAAGGGGTGAAGATGGCTCCGTTGAGCTC
GACGTCGGTCGTCTGGGCGGCGTATCCGAGTGCCTCGTCGTCAGCTACGTCCGCAACGATCGAGTCGTCGGCCGC
TCACGCCCCCACCGACGACAACGAAACGCAACCTCCCTCGAGTCCCGCGTCCTCGAAGCCCGCAATACAATCTTC
TCTCAGGAGCTGTGGCACGAGCTCATCAAGGAGGCCCGCACGCTGGCCGCCTACGACGTCCGTCTCCAGGGCTCA
CAACTCCGATGCCGGGTCGACGACGAGACTGCCCTGACCATGGAGCTCCTCGAGCTCAGCTCCTGTCCAGCCCCG
GACGACTCCCTACCGTACAACGACATGGCCGAAGCCGTCTCTCTCGGTCTTCACATGCTGCTCTCCTACGCCCAT
CGCCACAACGAGCTGATGCGCACCCGACCCATGCCACCACACATGTCCCGCTCACGTCCCACCAACCAGACCTAC
GCCCTCCTCCGCCCCATCATCGCCCGTCTAGTCTCCGACGCCAGCATCGAGGCCTGCACCCGCCTGGTAGGCAGC
CTCTCCCGCGCACTGACAAAGGCAGGCCTCGCCTCATCCTTCACCCTCCGACCCTCGTCCTCTCCAACAACCGAT
CCTTCCTCCTCCTCCCCTTCGAGCCACGCTTCGCCATCGCAGACACTCATCCGCAACATGCTCCAGCCACGCGAC
CTGGCCATCGACTTCTCCATCCTCCCAGACATCTCCCTCTCCATCCGCCTCCGCACCTTTCTCTTCCCCGTCACG
TCCAGCCACTTCAACGTCAGCCTCCCGCCCGACTCCCCCCTCCGCCCCTCGAGCGCCCCCTACCAAGACGGATAC
CCAGACGTGCGCGCCCTGGCCGACTACCTCGACACCACCGTCTCCCGCTGCCTAACCCGCCACTTCCTCTCCCGC
CTCCCACCCGACGACGCCAACGGCAACACCCGCCGCTGGACCGAGACCATCGTCGGCACCTCGATCCGCGATCCG
GACTCCGACCGCTGGTCCCTCCGCTTCTCAACCGTCCGCAACGACGCCGATCCCATCCCCTCCGCCGCCCTCATC
CTCGCAAGCTCCGTCGTCGGCCCGGACGGCGACCCTCCCCGTCGCCGCTCCTGGAAGTGGTCCTCCGGGGAGAAT
CCCGAAGACGAACCTCGCTCCATGGCCGACGTCGTCGCCGAGGTGGCCCGCATGACGCCTTCTTAG
Transcript >Ophun1|6363
ATGAGACCCTACCTGTCGCTGTACCTCCTCTCGAGCATCACCGCCGCAGACTGCAGCACCACAAACTGCAAGTCC
TTTCATGGATCTCGCGATTGGCCTTCTCATAGTGTCTGGGCGAGCCTCAATGGCACGCTAGGCGGGCGTCTCCTC
GCACCGCTCCCCCCTGGCGCAGTCTGTCACGCCGAGCAGCCGTCATACAACGCCAGTGCATGTCCCGAACGCAAG
AAAGAATGGTCCCGTTACGAGTGGCACGCAGAGGATCCCCTCTCTGTTATGTGGGATCAGTTTACGCACTATAGC
TGTCTGCCTGATGCCAACGCCCCCTGCACCGCTCGGGGCTATCCCACGTACGTCGTCAATGCATCTACCGCAGAG
CACGTCAAGACTGGTATCGACTTTGCCAGAAATCACAACATCAGGCTCGTCGTCAAGAACAGCGGACACGACTTC
ATCGGCCGATCTGTTGCTCCTGGAGCACTCTCTATCTGGGCCCATAATCTAAACACCATCAAGTTCAACCCGGAA
GAGTTCAAGCTCGATGGCTCCAGCCGAGTTATCAAGACCAACTCCATGACTATCGGCGGCGGAGTTCAAATGTAC
GATGCTTACAAGGCGGCTGATCAGCACGGACAGACCATTACCGGCGGCGGAGGAAAGTCGGTTGCCTTTGGCGGC
TACGTCTCTGGCGGCGGGCATTCGTTTGTTGCGCCGTACTTTGGCTTGGCTGCTGATAACATTTTGCAAATGGAG
GTTGTTACTCCAGCTGGGGATATCATGACCGTCAACGAGGATCAATACCCGGAAATCTTCTGGGCCTTGAGAGGC
GGCGGAGGCTCAACCTTTGGCGTCATCACCAGCCTGACCATCAAATCCTACCCCAAGGCAAGAGTCAGCTATACT
AGCTACAAGATCGTCGCCGATCCTCAAGCACCTTTTCTGTGGGACATGATCACCTATGTCATCTCACAGCTGCCC
TATCTTATGGACTCTGGGTTCGCCGGCAAAAACTTTGTGAACCACAGCATGCCGAACCCTGACCCATCGTCCGGC
TTGCCCAGCAAGGTGGCAGGAGTATCGGGCCAGAACCTTTTGCTGAATGCTAGCGAGCCCAATATTGCGGCGAAG
ATCTTTAAGCCCATCAACGATACCCTGCAGTCGAGATGGCCCGGAAAGGTTCTGCTGCATCTAGAAACACAACAC
TATCCAACCTCCTTGGCCTGGTTCGAAAAGAACTACGATGCTAGCACTGGCGGCTACTCGCGCTACCTCGTATCG
CGGCTATTGGACAAGCAGTCACTGACAGGCAACGAAACGGCGCTACGAGATGCACTGAAAGCAGCCAACGAGCCC
AACGGCCTCTTAGCCTTCTTCACAGTTGCTGGAAAGGGAGTTCAGAATGCGAAGCCGCGGGGAGGAGACGCTGTT
CATCCAGCCTGGCGCCAGGCCTATGTTCACTCTGTTGCCACGGCTGAGTTTCCGCCGTTCAACAAGACGGCCGAG
AGGGAGGCGATTGCGATACTTGACCGATCTTTCCAGCCTTTGCGAGATCTGACGCCAAATTCGGGAGCTTATATG
AACGAGGCGCTTCCGTTTGAGAAAGACTGGCAGCATACCTTCTGGGGGAGCAACTACGAGAGACTGCTGGCGATC
AAGAAGAATGTCGATCCGACTGATGTGTTTTGCTACACAGCCTCATGCCCGGGCATGACCATCGGAGACTCCATC
GGAGACTCCAAGCATCACCACCAAGCATCAGCAAACCCCATCCCCCGTCGACAGCCCACGCATGAAGCTCTCCAC
TGCCCGGCTCCAGCCACAGCCACCATGTCGGCAGCTGAAGCCACCTTCCTCTCGCTGAGGCCGGTGCCCATCGCC
GACAAGGAGCCCAAGAACCTGGCGGAATTCATCTCGCGTGTCAATGCTCAGCCTGGCGGTTTTCGCGATGTCACC
GAGTCAGCTCTTCGAGAAGCCATCGAGACGAACGGAGACGCTTCTGTCGAGGATGTCGTCATGGTCGATGCTGTT
GAGGAGGAAGATGCTGCAGCTCCGTCGAAAGACGCCGCTTCAGCTCGTCTGGAGGTGCTCAAGGGCGTAGACATC
GCCGGAAACACAGCCATGCTCATCCTCGACTCCCTCTCTCTCCTCCTCTCGAAGCAAAGCCCGACCTCGGCTAGC
CTGACGCTCTCACAACAGCTCCGCGACATGGTAGGCATCGGCACCCTCAGCGTCGACCGCCTCGACGAACCGACA
GCCCGCGAAGAGCGCGTCAAGGACGGCGAGCAGGTCGCAACGGGCTGGACCCTAATGGAAATCAACAAGACGCGT
GACGCCGCCGTCTCAGCCGCCGCCTTGCTGGACAAGGAGGTGGCCATCGAGAGCAGATACTGGGACGACGTCATG
GCGGTTAAGAAGGCCGGCTGGTCCATGTGCCGCGTCCCCAACGAGAGACACACGCTCGGCGTCCGCTTCGGCTTC
TCCGAGACGTCGACCGAGTTCAAGAATAACGGGCTGGCGCCGATGCGAAGGGGTGAAGATGGCTCCGTTGAGCTC
GACGTCGGTCGTCTGGGCGGCGTATCCGAGTGCCTCGTCGTCAGCTACGTCCGCAACGATCGAGTCGTCGGCCGC
TCACGCCCCCACCGACGACAACGAAACGCAACCTCCCTCGAGTCCCGCGTCCTCGAAGCCCGCAATACAATCTTC
TCTCAGGAGCTGTGGCACGAGCTCATCAAGGAGGCCCGCACGCTGGCCGCCTACGACGTCCGTCTCCAGGGCTCA
CAACTCCGATGCCGGGTCGACGACGAGACTGCCCTGACCATGGAGCTCCTCGAGCTCAGCTCCTGTCCAGCCCCG
GACGACTCCCTACCGTACAACGACATGGCCGAAGCCGTCTCTCTCGGTCTTCACATGCTGCTCTCCTACGCCCAT
CGCCACAACGAGCTGATGCGCACCCGACCCATGCCACCACACATGTCCCGCTCACGTCCCACCAACCAGACCTAC
GCCCTCCTCCGCCCCATCATCGCCCGTCTAGTCTCCGACGCCAGCATCGAGGCCTGCACCCGCCTGGTAGGCAGC
CTCTCCCGCGCACTGACAAAGGCAGGCCTCGCCTCATCCTTCACCCTCCGACCCTCGTCCTCTCCAACAACCGAT
CCTTCCTCCTCCTCCCCTTCGAGCCACGCTTCGCCATCGCAGACACTCATCCGCAACATGCTCCAGCCACGCGAC
CTGGCCATCGACTTCTCCATCCTCCCAGACATCTCCCTCTCCATCCGCCTCCGCACCTTTCTCTTCCCCGTCACG
TCCAGCCACTTCAACGTCAGCCTCCCGCCCGACTCCCCCCTCCGCCCCTCGAGCGCCCCCTACCAAGACGGATAC
CCAGACGTGCGCGCCCTGGCCGACTACCTCGACACCACCGTCTCCCGCTGCCTAACCCGCCACTTCCTCTCCCGC
CTCCCACCCGACGACGCCAACGGCAACACCCGCCGCTGGACCGAGACCATCGTCGGCACCTCGATCCGCGATCCG
GACTCCGACCGCTGGTCCCTCCGCTTCTCAACCGTCCGCAACGACGCCGATCCCATCCCCTCCGCCGCCCTCATC
CTCGCAAGCTCCGTCGTCGGCCCGGACGGCGACCCTCCCCGTCGCCGCTCCTGGAAGTGGTCCTCCGGGGAGAAT
CCCGAAGACGAACCTCGCTCCATGGCCGACGTCGTCGCCGAGGTGGCCCGCATGACGCCTTCTTAG
Gene >Ophun1|6363
ATGAGACCCTACCTGTCGCTGTACCTCCTCTCGAGCATCACCGCCGCAGACTGCAGCACCACAAACTGCAAGTCC
TTTCATGGATCTCGCGATTGGCCTTCTCATAGTGTCTGGGCGAGCCTCAATGGCACGCTAGGCGGGCGTCTCCTC
GCACCGCTCCCCCCTGGCGCAGTCTGTCACGCCGAGCAGCCGTCATACAACGCCAGTGCATGTCCCGAACGCAAG
AAAGAATGGTCCCGTTACGAGTGGCACGCAGAGGATCCCCTCTCTGTTATGTGGGATCAGTTTACGCACTATAGC
TGTCTGCCTGATGCCAACGCCCCCTGCACCGCTCGGGGCTATCCCACGTACGTCGTCAATGCATCTACCGCAGAG
CACGTCAAGACTGGTATCGACTTTGGTATGTACGTAACCACGGATAACGGAGAAAAAATTCTAAAGAGCCAAATC
TAGCCAGAAATCACAACATCAGGCTCGTCGTCAAGAACAGCGGACACGACTTCATCGGCCGATCTGTTGCTCCTG
GAGCACTCTCTATCTGGGCCCATAATCTAAACACCATCAAGTTCAACCCGGAAGAGTTCAAGCTCGATGGCTCCA
GCCGAGTTATCAAGACCAACTCCATGACTATCGGCGGCGGAGTTCAAATGTACGATGCTTACAAGGCGGCTGATC
AGCACGGACAGACCATTACCGGCGGCGGAGGAAAGTCGGTTGCCTTTGGCGGCTACGTCTCTGGCGGCGGGCATT
CGTTTGTTGCGCCGTACTTTGGCTTGGCTGCTGATAACATTTTGCAAATGGAGGTTGTTACTCCAGCTGGGGATA
TCATGACCGTCAACGAGGATCAATACCCGGAAATCTTCTGGGCCTTGAGAGGCGTGCGTATCACCTAAGAATCCG
AGAAGGACTCTGACTGACGTGCTTCATCTTATTCAGGGCGGAGGCTCAACCTTTGGCGTCATCACCAGCCTGACC
ATCAAATCCTACCCCAAGGCAAGAGTCAGCTATACTAGCTACAAGATCGTCGCCGATCCTCAAGCACCTTTTCTG
TGGGACATGATCACCTATGTCATCTCACAGCTGCCCTATCTTATGGACTCTGGGTTCGCCGGCAAAAACTTTGTG
AACCACAGCATGCCGAACCCTGACCCATCGTCCGGCTTGCCCAGCAAGGTGGCAGGAGTATCGGGCCAGAACCTT
TTGCTGAATGCTAGCGAGCCCAATATTGCGGCGAAGATCTTTAAGCCCATCAACGATACCCTGCAGTCGAGATGG
CCCGGAAAGGTTCTGCTGCATCTAGAAACACAACACTATCCAACCTCCTTGGCCTGGTTCGAAAAGAACTACGAT
GCTAGCACTGGCGGCTACTCGCGCTACCTCGTATCGCGGCTATTGGACAAGCAGTCACTGACAGGCAACGAAACG
GCGCTACGAGATGCACTGAAAGCAGCCAACGAGCCCAACGGCCTCTTAGCCTTCTTCACAGTTGCTGGAAAGGGA
GTTCAGAATGCGAAGCCGCGGGGAGGAGACGCTGTTCATCCAGCCTGGCGCCAGGCCTATGTTCACTCTGTTGCC
ACGGCTGAGTTTCCGCCGTTCAACAAGACGGCCGAGAGGGAGGCGATTGCGATACTTGACCGATCTTTCCAGCCT
TTGCGAGATCTGACGCCAAATTCGGGAGCTTATATGAACGAGGTAGGCAGAATCCATTCTTTTTTGAGGCAGAGC
AGACGACTGACGACTTGGCTCTGGAACAGGCGCTTCCGTTTGAGAAAGACTGGCAGCATACCTTCTGGGGGAGCA
ACTACGAGAGACTGCTGGCGATCAAGAAGAATGTCGATCCGACTGATGTGTTTTGGTGCTTCCCATGCGTCGGAA
GTGAAGGGTGGATGCAGCGCTCAGACGGCCATCTTTGCCGGAGACGGTGAAGCTGATGGACGAAGGAAGGGAGAA
AATTCGAGACATCGTGGGCGGTTCTAGAAGAAGTATTCTGTTCATTGTTAGCAGGGCCCATGTCGGCCTCTTTCT
GAGCGATTCTCCAGCAACTTGGTGTAGCGTGAGAAATACATGTATCCATTGGCGTCTGTCGTCGGCAGCTTCAAG
CTCGACCGCACGTGATATTTACCGCCCTTTCCAGCCCTACGCCACCTTAGCCACACCACACAGCTACACAGCCTC
ATGCCCGGGCATGACCATCGGAGACTCCATCGGAGACTCCAAGCATCACCACCAAGCATCAGCAAACCCCATCCC
CCGTCGACAGCCCACGCATGAAGCTCTCCACTGCCCGGCTCCAGCCACAGCCACCATGTCGGCAGCTGAAGCCAC
CTTCCTCTCGCTGAGGCCGGTGCCCATCGCCGACAAGGAGCCCAAGAACCTGGCGGAATTCATCTCGCGTGTCAA
TGCTCAGCCTGGCGGTTTTCGCGATGTCACCGAGTCAGCTCTTCGAGAAGCCATCGAGACGAACGGAGACGCTTC
TGTCGAGGATGTCGTCATGGTCGATGCTGTTGAGGAGGAAGATGCTGCAGCTCCGTCGAAAGACGCCGCTTCAGC
TCGTCTGGAGGTGCTCAAGGGCGTAGAGTACGTTTGCCTCTTCCCTCATCAACAACGATAATAACTAAACCGCAC
TCAGCATCGCCGGAAACACAGCCATGCTCATCCTCGACTCCCTCTCTCTCCTCCTCTCGAAGCAAAGCCCGACCT
CGGCTAGCCTGACGCTCTCACAACAGCTCCGCGACATGGTAGGCATCGGCACCCTCAGCGTCGACCGCCTCGACG
AACCGACAGCCCGCGAAGAGCGCGTCAAGGACGGCGAGCAGGTCGCAACGGGCTGGACCCTAATGGAAATCAACA
AGACGCGTGACGCCGCCGTCTCAGCCGCCGCCTTGCTGGACAAGGAGGTGGCCATCGAGAGCAGATACTGGGACG
ACGTCATGGCGGTTAAGAAGGCCGGCTGGTCCATGTGCCGCGTCCCCAACGAGAGACACACGCTCGGCGTCCGCT
TCGGCTTCTCCGAGACGTCGACCGAGTTCAAGAATAACGGGCTGGCGCCGATGCGAAGGGGTGAAGATGGCTCCG
TTGAGCTCGACGTCGGTCGTCTGGGCGGCGTATCCGAGTGCCTCGTCGTCAGCTACGTCCGCAACGATCGAGTCG
TCGGCCGCTCACGCCCCCACCGACGACAACGAAACGCAACCTCCCTCGAGTCCCGCGTCCTCGAAGCCCGCAATA
CAATCTTCTCTCAGGAGCTGTGGCACGAGCTCATCAAGGAGGCCCGCACGCTGGCCGCCTACGACGTCCGTCTCC
AGGGCTCACAACTCCGATGCCGGGTCGACGACGAGACTGCCCTGACCATGGAGCTCCTCGAGCTCAGCTCCTGTC
CAGCCCCGGACGACTCCCTACCGTACAACGACATGGCCGAAGCCGTCTCTCTCGGTCTTCACATGCTGCTCTCCT
ACGCCCATCGCCACAACGAGCTGATGCGCACCCGACCCATGCCACCACACATGTCCCGCTCACGTCCCACCAACC
AGACCTACGCCCTCCTCCGCCCCATCATCGCCCGTCTAGTCTCCGACGCCAGCATCGAGGCCTGCACCCGCCTGG
TAGGCAGCCTCTCCCGCGCACTGACAAAGGCAGGCCTCGCCTCATCCTTCACCCTCCGACCCTCGTCCTCTCCAA
CAACCGATCCTTCCTCCTCCTCCCCTTCGAGCCACGCTTCGCCATCGCAGACACTCATCCGCAACATGCTCCAGC
CACGCGACCTGGCCATCGACTTCTCCATCCTCCCAGACATCTCCCTCTCCATCCGCCTCCGCACCTTTCTCTTCC
CCGTCACGTCCAGCCACTTCAACGTCAGCCTCCCGCCCGACTCCCCCCTCCGCCCCTCGAGCGCCCCCTACCAAG
ACGGATACCCAGACGTGCGCGCCCTGGCCGACTACCTCGACACCACCGTCTCCCGCTGCCTAACCCGCCACTTCC
TCTCCCGCCTCCCACCCGACGACGCCAACGGCAACACCCGCCGCTGGACCGAGACCATCGTCGGCACCTCGATCC
GCGATCCGGACTCCGACCGCTGGTCCCTCCGCTTCTCAACCGTCCGCAACGACGCCGATCCCATCCCCTCCGCCG
CCCTCATCCTCGCAAGCTCCGTCGTCGGCCCGGACGGCGACCCTCCCCGTCGCCGCTCCTGGAAGTGGTCCTCCG
GGGAGAATCCCGAAGACGAACCTCGCTCCATGGCCGACGTCGTCGCCGAGGTGGCCCGCATGACGCCTTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail