Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6356
Gene name
LocationContig_69:10099..10846
Strand-
Gene length (bp)747
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 5.0E-11 64 190
PF06293 Kdo Lipopolysaccharide kinase (Kdo/WaaP) family 2.0E-09 62 220
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.5E-06 64 190
PF03109 ABC1 ABC1 atypical kinase-like domain 3.2E-06 81 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HYC1|BUD32_GIBZE EKC/KEOPS complex subunit BUD32 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BUD32 PE=3 SV=1 9 248 1.0E-125
sp|Q2HGY8|BUD32_CHAGB EKC/KEOPS complex subunit BUD32 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BUD32 PE=3 SV=1 10 248 1.0E-99
sp|A1CLD2|BUD32_ASPCL EKC/KEOPS complex subunit bud32 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bud32 PE=3 SV=1 22 248 7.0E-86
sp|Q4WYU4|BUD32_ASPFU EKC/KEOPS complex subunit bud32 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bud32 PE=3 SV=1 22 248 8.0E-84
sp|Q5BAB7|BUD32_EMENI EKC/KEOPS complex subunit bud32 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bud32 PE=3 SV=1 24 248 5.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HYC1|BUD32_GIBZE EKC/KEOPS complex subunit BUD32 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BUD32 PE=3 SV=1 9 248 1.0E-125
sp|Q2HGY8|BUD32_CHAGB EKC/KEOPS complex subunit BUD32 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BUD32 PE=3 SV=1 10 248 1.0E-99
sp|A1CLD2|BUD32_ASPCL EKC/KEOPS complex subunit bud32 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bud32 PE=3 SV=1 22 248 7.0E-86
sp|Q4WYU4|BUD32_ASPFU EKC/KEOPS complex subunit bud32 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bud32 PE=3 SV=1 22 248 8.0E-84
sp|Q5BAB7|BUD32_EMENI EKC/KEOPS complex subunit bud32 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bud32 PE=3 SV=1 24 248 5.0E-82
sp|Q1EBD3|BUD32_COCIM EKC/KEOPS complex subunit BUD32 OS=Coccidioides immitis (strain RS) GN=BUD32 PE=3 SV=1 23 248 6.0E-81
sp|Q2U3T8|BUD32_ASPOR EKC/KEOPS complex subunit bud32 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bud32 PE=3 SV=1 26 248 9.0E-78
sp|Q54W07|BUD32_DICDI EKC/KEOPS complex subunit bud32 OS=Dictyostelium discoideum GN=bud32 PE=3 SV=1 23 248 2.0E-62
sp|Q9P7N1|BUD32_SCHPO EKC/KEOPS complex subunit SPAP27G11.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP27G11.07c PE=3 SV=1 23 248 3.0E-61
sp|Q96S44|PRPK_HUMAN TP53-regulating kinase OS=Homo sapiens GN=TP53RK PE=1 SV=2 22 248 2.0E-55
sp|Q99PW4|PRPK_MOUSE TP53-regulating kinase OS=Mus musculus GN=Tp53rk PE=2 SV=1 22 248 6.0E-53
sp|Q6C2A3|BUD32_YARLI EKC/KEOPS complex subunit BUD32 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUD32 PE=3 SV=1 18 248 1.0E-46
sp|Q74Z75|BUD32_ASHGO EKC/KEOPS complex subunit BUD32 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BUD32 PE=3 SV=1 24 248 6.0E-41
sp|Q6CXB9|BUD32_KLULA EKC/KEOPS complex subunit BUD32 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUD32 PE=3 SV=1 24 248 1.0E-40
sp|Q6FTW0|BUD32_CANGA EKC/KEOPS complex subunit BUD32 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BUD32 PE=3 SV=1 24 248 1.0E-40
sp|P0CP72|BUD32_CRYNJ EKC/KEOPS complex subunit BUD32 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BUD32 PE=3 SV=1 16 248 2.0E-40
sp|P0CP73|BUD32_CRYNB EKC/KEOPS complex subunit BUD32 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BUD32 PE=3 SV=1 16 248 2.0E-40
sp|Q6BHA8|BUD32_DEBHA EKC/KEOPS complex subunit BUD32 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BUD32 PE=3 SV=2 23 248 1.0E-39
sp|P53323|BUD32_YEAST EKC/KEOPS complex subunit BUD32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD32 PE=1 SV=1 24 248 2.0E-38
sp|Q5AGC7|BUD32_CANAL EKC/KEOPS complex subunit BUD32 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD32 PE=3 SV=1 22 248 6.0E-35
sp|O27476|KAE1B_METTH Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1425 PE=3 SV=1 22 242 5.0E-32
sp|Q9UYB9|BUD32_PYRAB KEOPS complex subunit Bud32 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=bud32 PE=1 SV=1 23 245 4.0E-31
sp|Q58530|KAE1B_METJA Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1130 PE=1 SV=2 23 242 1.0E-29
sp|Q8PZ92|KAE1B_METMA Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0602 PE=3 SV=2 21 242 1.0E-29
sp|Q8TJS2|KAE1B_METAC Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3705 PE=3 SV=1 21 242 2.0E-29
sp|Q46FS9|KAE1B_METBF Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A0279 PE=3 SV=1 21 242 8.0E-29
sp|A5UMH5|KAE1B_METS3 Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=Msm_1198 PE=3 SV=1 22 224 9.0E-27
sp|B7XIB8|BUD32_ENTBH EKC/KEOPS complex subunit BUD32 OS=Enterocytozoon bieneusi (strain H348) GN=BUD32 PE=3 SV=1 23 244 3.0E-25
sp|Q6M056|KAE1B_METMP Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0415 PE=3 SV=1 23 242 8.0E-25
sp|A3CXS0|KAE1B_METMJ Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=Memar_2247 PE=3 SV=1 46 242 1.0E-24
sp|A6VJ51|KAE1B_METM7 Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_1414 PE=3 SV=1 23 242 5.0E-24
sp|Q8SVD9|BUD32_ENCCU EKC/KEOPS complex subunit BUD32 OS=Encephalitozoon cuniculi (strain GB-M1) GN=BUD32 PE=3 SV=1 26 247 1.0E-23
sp|A4FZ86|KAE1B_METM5 Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_1222 PE=3 SV=1 23 242 1.0E-22
sp|P36174|KAE1B_HALMA Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rrnAC2490 PE=3 SV=2 26 242 1.0E-21
sp|A6US28|KAE1B_METVS Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_1404 PE=3 SV=1 23 242 2.0E-21
sp|A9A6L6|KAE1B_METM6 Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=MmarC6_0494 PE=3 SV=1 23 242 3.0E-21
sp|Q2FS43|KAE1B_METHJ Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=Mhun_2868 PE=3 SV=1 45 242 5.0E-21
sp|A2SR70|KAE1B_METLZ Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=Mlab_0653 PE=3 SV=1 14 242 1.0E-20
sp|Q9HLA5|KAE1B_THEAC Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0324 PE=1 SV=1 27 242 1.0E-20
sp|Q2NIA4|KAE1B_METST Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=Msp_0013 PE=3 SV=1 26 242 4.0E-20
sp|Q3IMN2|KAE1B_NATPD Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=NP_5070A PE=3 SV=1 26 242 6.0E-20
sp|Q978W6|KAE1B_THEVO Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1299 PE=3 SV=1 27 242 4.0E-18
sp|Q18KI0|KAE1B_HALWD Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=HQ_1341A PE=3 SV=1 46 242 1.0E-15
sp|O29592|BUD32_ARCFU Probable serine/threonine-protein kinase BUD32 homolog OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0665 PE=3 SV=1 44 242 5.0E-13
sp|Q9HNL6|KAE1B_HALSA Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_2045G PE=3 SV=2 20 242 1.0E-11
sp|Q6L243|KAE1B_PICTO Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0374 PE=3 SV=1 13 238 3.0E-11
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 24 189 1.0E-08
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 16 189 1.0E-07
sp|Q822K5|PKND_CHLCV Serine/threonine-protein kinase PknD OS=Chlamydophila caviae (strain GPIC) GN=pknD PE=3 SV=1 37 197 3.0E-06
sp|Q5L5J7|PKND_CHLAB Serine/threonine-protein kinase PknD OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=pknD PE=3 SV=1 37 195 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6356
MATNPTPQLPAILQFPASASSELITQGAEARLYKTSYLRPDLPCALKYRPPKPWRHPVLDQRLTKHRILTEARIL
AKCRRDGVRVPTVYAIDEAAGWLMLEWIPGNPVRVAINDWLAQASTPVDQDDTLRALLRRIGSAVGLMHKMGVVH
GDLTTSNIMLSPPPQGSHCLAGEIVIIDFGLASGSIQDEDRAVDLYVLERAFGSTHPAAESVFEEVLEAYKHTFN
HAPIVLKRLKDVRMRGRKRSMLG*
Coding >Ophun1|6356
ATGGCCACCAATCCCACGCCTCAGCTGCCCGCCATCCTCCAATTCCCGGCCTCGGCCTCGTCCGAGCTCATCACT
CAAGGCGCCGAAGCGCGGCTCTACAAGACAAGCTACCTGCGACCCGACCTCCCCTGCGCCCTCAAATACCGACCG
CCCAAGCCGTGGCGACACCCCGTTCTCGATCAGCGCCTCACCAAGCACCGCATCCTGACCGAGGCCCGCATCCTC
GCCAAGTGTCGCAGAGACGGCGTCCGCGTGCCGACCGTCTATGCCATCGATGAGGCCGCCGGCTGGCTGATGCTC
GAGTGGATTCCCGGCAACCCAGTTCGCGTCGCCATCAACGACTGGCTCGCTCAGGCCTCGACGCCCGTCGATCAG
GATGACACGCTCCGCGCTCTGCTGCGCCGTATCGGGTCCGCTGTCGGCCTCATGCACAAGATGGGCGTCGTCCAT
GGCGATCTGACGACGAGCAACATCATGCTCTCCCCGCCTCCCCAAGGCTCGCACTGCCTCGCGGGGGAAATCGTC
ATCATCGACTTTGGCCTCGCCAGCGGGAGCATACAAGACGAAGACCGAGCCGTCGACCTCTACGTTCTCGAGCGC
GCCTTTGGGAGTACGCACCCTGCGGCCGAGTCCGTATTTGAAGAGGTTCTCGAGGCGTATAAGCATACCTTCAAC
CACGCGCCCATCGTCCTCAAGCGACTCAAAGACGTCCGCATGAGAGGTAGAAAACGAAGCATGCTCGGATGA
Transcript >Ophun1|6356
ATGGCCACCAATCCCACGCCTCAGCTGCCCGCCATCCTCCAATTCCCGGCCTCGGCCTCGTCCGAGCTCATCACT
CAAGGCGCCGAAGCGCGGCTCTACAAGACAAGCTACCTGCGACCCGACCTCCCCTGCGCCCTCAAATACCGACCG
CCCAAGCCGTGGCGACACCCCGTTCTCGATCAGCGCCTCACCAAGCACCGCATCCTGACCGAGGCCCGCATCCTC
GCCAAGTGTCGCAGAGACGGCGTCCGCGTGCCGACCGTCTATGCCATCGATGAGGCCGCCGGCTGGCTGATGCTC
GAGTGGATTCCCGGCAACCCAGTTCGCGTCGCCATCAACGACTGGCTCGCTCAGGCCTCGACGCCCGTCGATCAG
GATGACACGCTCCGCGCTCTGCTGCGCCGTATCGGGTCCGCTGTCGGCCTCATGCACAAGATGGGCGTCGTCCAT
GGCGATCTGACGACGAGCAACATCATGCTCTCCCCGCCTCCCCAAGGCTCGCACTGCCTCGCGGGGGAAATCGTC
ATCATCGACTTTGGCCTCGCCAGCGGGAGCATACAAGACGAAGACCGAGCCGTCGACCTCTACGTTCTCGAGCGC
GCCTTTGGGAGTACGCACCCTGCGGCCGAGTCCGTATTTGAAGAGGTTCTCGAGGCGTATAAGCATACCTTCAAC
CACGCGCCCATCGTCCTCAAGCGACTCAAAGACGTCCGCATGAGAGGTAGAAAACGAAGCATGCTCGGATGA
Gene >Ophun1|6356
ATGGCCACCAATCCCACGCCTCAGCTGCCCGCCATCCTCCAATTCCCGGCCTCGGCCTCGTCCGAGCTCATCACT
CAAGGCGCCGAAGCGCGGCTCTACAAGACAAGCTACCTGCGACCCGACCTCCCCTGCGCCCTCAAATACCGACCG
CCCAAGCCGTGGCGACACCCCGTTCTCGATCAGCGCCTCACCAAGCACCGCATCCTGACCGAGGCCCGCATCCTC
GCCAAGTGTCGCAGAGACGGCGTCCGCGTGCCGACCGTCTATGCCATCGATGAGGCCGCCGGCTGGCTGATGCTC
GAGTGGATTCCCGGCAACCCAGTTCGCGTCGCCATCAACGACTGGCTCGCTCAGGCCTCGACGCCCGTCGATCAG
GATGACACGCTCCGCGCTCTGCTGCGCCGTATCGGGTCCGCTGTCGGCCTCATGCACAAGATGGGCGTCGTCCAT
GGCGATCTGACGACGAGCAACATCATGCTCTCCCCGCCTCCCCAAGGCTCGCACTGCCTCGCGGGGGAAATCGTC
ATCATCGACTTTGGCCTCGCCAGCGGGAGCATACAAGACGAAGACCGAGCCGTCGACCTCTACGTTCTCGAGCGC
GCCTTTGGGAGTACGCACCCTGCGGCCGAGTCCGTATTTGAAGAGGTTCTCGAGGCGTATAAGCATACCTTCAAC
CACGCGCCCATCGTCCTCAAGCGACTCAAAGACGTCCGCATGAGAGGTAGAAAACGAAGCATGCTCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail