Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6352
Gene name
LocationContig_689:7278..9223
Strand+
Gene length (bp)1945
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08245 Mur_ligase_M Mur ligase middle domain 1.4E-05 121 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD0|FOLD_SCHPO Probable dihydrofolate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol3 PE=3 SV=1 29 440 7.0E-47
sp|Q12676|FOLD_YEAST Dihydrofolate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL3 PE=1 SV=1 29 443 2.0E-38
sp|Q05865|FOLC_BACSU Folylpolyglutamate synthase OS=Bacillus subtilis (strain 168) GN=folC PE=3 SV=2 8 438 3.0E-29
sp|Q8W035|FPGS3_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS3 PE=1 SV=1 49 338 1.0E-25
sp|Q54CY5|FOLC_DICDI Putative folylpolyglutamate synthase OS=Dictyostelium discoideum GN=folC PE=3 SV=1 49 227 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD0|FOLD_SCHPO Probable dihydrofolate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol3 PE=3 SV=1 29 440 7.0E-47
sp|Q12676|FOLD_YEAST Dihydrofolate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL3 PE=1 SV=1 29 443 2.0E-38
sp|Q05865|FOLC_BACSU Folylpolyglutamate synthase OS=Bacillus subtilis (strain 168) GN=folC PE=3 SV=2 8 438 3.0E-29
sp|Q8W035|FPGS3_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS3 PE=1 SV=1 49 338 1.0E-25
sp|Q54CY5|FOLC_DICDI Putative folylpolyglutamate synthase OS=Dictyostelium discoideum GN=folC PE=3 SV=1 49 227 5.0E-24
sp|P15925|FOLC_LACCA Folylpolyglutamate synthase OS=Lactobacillus casei GN=fgs PE=1 SV=1 49 434 3.0E-23
sp|F4K2A1|FPGS1_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS1 PE=1 SV=1 49 227 3.0E-23
sp|A6H751|FOLC_BOVIN Folylpolyglutamate synthase, mitochondrial OS=Bos taurus GN=FPGS PE=2 SV=1 49 364 9.0E-23
sp|P48760|FOLC_MOUSE Folylpolyglutamate synthase, mitochondrial OS=Mus musculus GN=Fpgs PE=1 SV=3 49 221 2.0E-22
sp|Q05932|FOLC_HUMAN Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens GN=FPGS PE=1 SV=3 49 248 2.0E-22
sp|F4J2K2|FPGS2_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS2 PE=1 SV=1 49 242 2.0E-21
sp|P43775|FOLC_HAEIN Folylpolyglutamate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folC PE=3 SV=1 22 220 2.0E-21
sp|Q924L9|FOLC_CRIGR Folylpolyglutamate synthase, mitochondrial OS=Cricetulus griseus GN=FPGS PE=2 SV=1 49 221 6.0E-21
sp|Q09509|FOLC_CAEEL Putative folylpolyglutamate synthase OS=Caenorhabditis elegans GN=F25B5.6 PE=3 SV=1 49 217 8.0E-21
sp|P08192|FOLC_ECOLI Bifunctional protein FolC OS=Escherichia coli (strain K12) GN=folC PE=1 SV=2 27 226 2.0E-19
sp|F4JYE9|DHFS_ARATH Dihydrofolate synthetase OS=Arabidopsis thaliana GN=DHFS PE=1 SV=1 49 211 3.0E-19
sp|Q9Y893|FOLE_CANAX Folylpolyglutamate synthase OS=Candida albicans GN=MET7 PE=3 SV=1 49 211 2.0E-17
sp|Q8K9X3|FOLC_BUCAP Bifunctional protein FolC OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=folC PE=3 SV=1 51 221 6.0E-17
sp|O74742|FOLE_SCHPO Probable folylpolyglutamate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met7 PE=2 SV=1 49 234 2.0E-16
sp|Q89AT2|FOLC_BUCBP Bifunctional protein FolC OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=folC PE=3 SV=1 51 226 8.0E-16
sp|D4GW05|FOLCP_HALVD Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=folCP PE=3 SV=1 49 227 1.0E-15
sp|O13492|FOLE_NEUCR Folylpolyglutamate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-6 PE=1 SV=2 49 291 1.0E-14
sp|Q9HS44|FOLCP_HALSA Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=folP PE=3 SV=1 49 222 2.0E-14
sp|B5VSC3|FOLE_YEAS6 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MET7 PE=3 SV=2 49 235 3.0E-14
sp|E7QKX4|FOLE_YEASZ Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=MET7 PE=3 SV=2 49 235 3.0E-14
sp|Q08645|FOLE_YEAST Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET7 PE=1 SV=1 49 235 3.0E-14
sp|E7KUJ4|FOLE_YEASL Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=MET7 PE=3 SV=2 49 235 3.0E-14
sp|C8ZGZ3|FOLE_YEAS8 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MET7 PE=3 SV=1 49 235 3.0E-14
sp|A6ZP80|FOLE_YEAS7 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain YJM789) GN=MET7 PE=3 SV=1 49 235 3.0E-14
sp|B3LJR0|FOLE_YEAS1 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MET7 PE=3 SV=1 49 235 3.0E-14
sp|E7KIA3|FOLE_YEASA Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain AWRI796) GN=MET7 PE=3 SV=2 49 235 3.0E-14
sp|E7NMM0|FOLE_YEASO Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain FostersO) GN=MET7 PE=3 SV=2 49 235 4.0E-14
sp|E7Q9C7|FOLE_YEASB Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain FostersB) GN=MET7 PE=3 SV=2 49 235 4.0E-14
sp|P57265|FOLC_BUCAI Bifunctional protein FolC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=folC PE=3 SV=1 51 209 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0009058 biosynthetic process Yes
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0097367 carbohydrate derivative binding No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4383
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5188
Ophiocordyceps australis map64 (Brazil) OphauB2|4866
Ophiocordyceps camponoti-floridani Ophcf2|06874
Ophiocordyceps camponoti-rufipedis Ophun1|6352 (this protein)
Ophiocordyceps kimflemingae Ophio5|2913
Ophiocordyceps subramaniannii Hirsu2|9076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6352
MPTSITDIKRALARIRELLPAEKRIERKIRLGLDRVRRVVPAKQDWIGVHVAGTNGKGSICTLLAGMLRRAGIGH
GVFLSPAMPEPHNGVLINGRYANRRMYELERDGVQAAYSRVSSGWTFATGETPDDLTPFELQTATAFRVFDKMHV
KYGIVEVGMGGSTDATNVMREKAVTIISRIGLDHQEYLGGTIEEIARVKAGIMRQGVPCIVDPSNPDEVMRVLSE
EAYNAGTQITMASRAEPLLAGLDRDRFRLEPYEERNLLCALLAFQKLFPNLKMDVNELVSTDSLLPGRKEKISVT
GLTGGLRRLPILVDGAHNMLGFEALAAHVQGSVRQGDEPVTWVMALSSSTSKPFAKMMETLVQPQDRLAFVEYVA
QDGDPPPTAADLGRDLGRIILRDDQSQLYDGDPSVGAGVVWACTEAGKGPVVVTGSLYMIRDLYQLEGVEPSRKI
GTMRPGPSQLWHYTRLAQERTLTADEESEFKRARRHNHLSPRRSHVFRHVRDGGQPKPVPVPDSVRQAQRTAAYH
KKQADGCKVAIESMREDRKKSSSDGHLDKTMKELQRKQQEHLREYRRTMLRVRGRNPDPNRKFTSYQDIFRKAKP
SKQTAKPNSNSNVKPRSWRGSGRRR*
Coding >Ophun1|6352
ATGCCTACCTCCATTACGGATATCAAGCGAGCCCTCGCCCGGATACGGGAACTCTTGCCGGCGGAGAAGAGGATT
GAGCGCAAGATCCGGCTCGGACTCGACCGCGTCCGCCGCGTCGTCCCGGCCAAGCAGGACTGGATCGGCGTCCAC
GTCGCCGGCACCAACGGCAAGGGATCCATCTGCACGCTGCTGGCCGGCATGCTCCGACGGGCCGGCATCGGCCAC
GGCGTCTTCTTGTCACCGGCCATGCCGGAGCCGCACAACGGGGTGCTCATCAACGGCCGGTACGCCAACCGGCGT
ATGTACGAGTTGGAGAGGGACGGCGTTCAGGCCGCCTACAGCCGGGTCTCTTCCGGATGGACCTTTGCCACGGGC
GAGACGCCAGACGACCTGACGCCCTTTGAGCTGCAGACGGCCACTGCCTTTCGCGTCTTTGACAAGATGCACGTA
AAGTACGGCATCGTCGAGGTAGGCATGGGCGGCTCTACCGACGCGACAAACGTCATGCGCGAAAAGGCCGTCACC
ATCATCTCCCGCATCGGACTCGACCACCAAGAGTACCTCGGCGGCACCATCGAGGAGATTGCCCGCGTCAAGGCC
GGCATCATGCGTCAAGGGGTGCCGTGCATCGTCGACCCATCCAACCCGGACGAAGTCATGCGAGTCCTGTCCGAA
GAGGCCTACAACGCGGGCACGCAGATCACAATGGCGTCGCGGGCCGAGCCGCTGCTGGCCGGGCTCGACAGGGAC
CGCTTCCGGCTCGAGCCGTACGAGGAGCGGAATCTCCTGTGCGCCCTCCTGGCCTTTCAGAAGCTCTTCCCCAAC
CTCAAGATGGACGTCAACGAGCTCGTCTCGACCGACTCCCTGCTGCCGGGCCGGAAAGAGAAGATTAGCGTGACG
GGCCTTACCGGAGGCCTGCGCCGGCTGCCGATTCTGGTGGACGGGGCGCACAACATGCTGGGCTTCGAGGCGCTG
GCGGCCCACGTGCAAGGCAGCGTGCGGCAGGGGGACGAGCCGGTGACGTGGGTCATGGCCCTGTCGTCGAGCACG
TCGAAGCCGTTTGCCAAGATGATGGAGACGCTGGTCCAGCCACAGGACAGGCTCGCCTTTGTCGAATACGTGGCA
CAGGACGGCGACCCGCCCCCCACGGCGGCGGACCTCGGGCGCGACCTCGGGCGAATCATCCTCCGCGACGACCAG
AGCCAGCTGTACGACGGCGATCCGAGCGTCGGCGCCGGGGTGGTGTGGGCGTGCACCGAAGCCGGCAAAGGCCCC
GTGGTAGTGACGGGCAGCCTCTACATGATCCGCGACCTGTACCAGCTGGAGGGCGTGGAGCCGTCTCGCAAGATC
GGTACGATGCGTCCGGGGCCGTCACAGCTATGGCACTACACGCGGCTGGCGCAGGAGCGGACGCTGACGGCCGAC
GAGGAGAGCGAGTTCAAGCGGGCCCGCAGACACAACCACCTGTCCCCCCGGCGCAGCCACGTCTTCCGCCACGTC
CGGGACGGCGGCCAGCCGAAGCCGGTGCCGGTGCCGGACAGTGTCAGGCAGGCGCAGCGAACGGCGGCGTACCAC
AAGAAGCAGGCGGACGGGTGCAAGGTAGCCATTGAGAGCATGAGGGAGGACAGGAAGAAGTCGTCGTCGGACGGC
CATTTGGACAAGACGATGAAGGAGCTGCAGAGGAAACAACAGGAGCATTTGAGGGAGTACCGCAGAACTATGTTG
CGCGTCCGGGGCCGCAACCCGGACCCGAATAGAAAATTCACCAGTTACCAGGACATCTTCCGCAAGGCCAAGCCG
TCGAAACAGACGGCGAAGCCCAACTCCAACAGCAACGTGAAGCCGAGGAGCTGGAGAGGCAGCGGGAGGAGGAGA
TGA
Transcript >Ophun1|6352
ATGCCTACCTCCATTACGGATATCAAGCGAGCCCTCGCCCGGATACGGGAACTCTTGCCGGCGGAGAAGAGGATT
GAGCGCAAGATCCGGCTCGGACTCGACCGCGTCCGCCGCGTCGTCCCGGCCAAGCAGGACTGGATCGGCGTCCAC
GTCGCCGGCACCAACGGCAAGGGATCCATCTGCACGCTGCTGGCCGGCATGCTCCGACGGGCCGGCATCGGCCAC
GGCGTCTTCTTGTCACCGGCCATGCCGGAGCCGCACAACGGGGTGCTCATCAACGGCCGGTACGCCAACCGGCGT
ATGTACGAGTTGGAGAGGGACGGCGTTCAGGCCGCCTACAGCCGGGTCTCTTCCGGATGGACCTTTGCCACGGGC
GAGACGCCAGACGACCTGACGCCCTTTGAGCTGCAGACGGCCACTGCCTTTCGCGTCTTTGACAAGATGCACGTA
AAGTACGGCATCGTCGAGGTAGGCATGGGCGGCTCTACCGACGCGACAAACGTCATGCGCGAAAAGGCCGTCACC
ATCATCTCCCGCATCGGACTCGACCACCAAGAGTACCTCGGCGGCACCATCGAGGAGATTGCCCGCGTCAAGGCC
GGCATCATGCGTCAAGGGGTGCCGTGCATCGTCGACCCATCCAACCCGGACGAAGTCATGCGAGTCCTGTCCGAA
GAGGCCTACAACGCGGGCACGCAGATCACAATGGCGTCGCGGGCCGAGCCGCTGCTGGCCGGGCTCGACAGGGAC
CGCTTCCGGCTCGAGCCGTACGAGGAGCGGAATCTCCTGTGCGCCCTCCTGGCCTTTCAGAAGCTCTTCCCCAAC
CTCAAGATGGACGTCAACGAGCTCGTCTCGACCGACTCCCTGCTGCCGGGCCGGAAAGAGAAGATTAGCGTGACG
GGCCTTACCGGAGGCCTGCGCCGGCTGCCGATTCTGGTGGACGGGGCGCACAACATGCTGGGCTTCGAGGCGCTG
GCGGCCCACGTGCAAGGCAGCGTGCGGCAGGGGGACGAGCCGGTGACGTGGGTCATGGCCCTGTCGTCGAGCACG
TCGAAGCCGTTTGCCAAGATGATGGAGACGCTGGTCCAGCCACAGGACAGGCTCGCCTTTGTCGAATACGTGGCA
CAGGACGGCGACCCGCCCCCCACGGCGGCGGACCTCGGGCGCGACCTCGGGCGAATCATCCTCCGCGACGACCAG
AGCCAGCTGTACGACGGCGATCCGAGCGTCGGCGCCGGGGTGGTGTGGGCGTGCACCGAAGCCGGCAAAGGCCCC
GTGGTAGTGACGGGCAGCCTCTACATGATCCGCGACCTGTACCAGCTGGAGGGCGTGGAGCCGTCTCGCAAGATC
GGTACGATGCGTCCGGGGCCGTCACAGCTATGGCACTACACGCGGCTGGCGCAGGAGCGGACGCTGACGGCCGAC
GAGGAGAGCGAGTTCAAGCGGGCCCGCAGACACAACCACCTGTCCCCCCGGCGCAGCCACGTCTTCCGCCACGTC
CGGGACGGCGGCCAGCCGAAGCCGGTGCCGGTGCCGGACAGTGTCAGGCAGGCGCAGCGAACGGCGGCGTACCAC
AAGAAGCAGGCGGACGGGTGCAAGGTAGCCATTGAGAGCATGAGGGAGGACAGGAAGAAGTCGTCGTCGGACGGC
CATTTGGACAAGACGATGAAGGAGCTGCAGAGGAAACAACAGGAGCATTTGAGGGAGTACCGCAGAACTATGTTG
CGCGTCCGGGGCCGCAACCCGGACCCGAATAGAAAATTCACCAGTTACCAGGACATCTTCCGCAAGGCCAAGCCG
TCGAAACAGACGGCGAAGCCCAACTCCAACAGCAACGTGAAGCCGAGGAGCTGGAGAGGCAGCGGGAGGAGGAGA
TGA
Gene >Ophun1|6352
ATGCCTACCTCCATTACGGATATCAAGCGAGCCCTCGCCCGGATACGGGAACTCTTGCCGGCGGAGAAGAGGATT
GAGCGCAAGATCCGGCTCGGACTCGACCGCGTCCGCCGCGTCGTCCCGGCCAAGCAGGACTGGATCGGCGTCCAC
GTCGCCGGCACCAACGGCAAGGGATCCATCTGCACGCTGCTGGCCGGCATGCTCCGACGGGCCGGCATCGGCCAC
GGCGTCTTCTTGTCACCGGCCATGCCGGAGCCGCACAACGGGGTGCTCATCAACGGCCGGTACGCCAACCGGCGT
ATGTACGAGTTGGAGAGGGACGGCGTTCAGGCCGCCTACAGCCGGGTCTCTTCCGGATGGACCTTTGCCACGGGC
GAGACGCCAGACGACCTGACGCCCTTTGAGCTGCAGACGGCCACTGCCTTTCGCGTCTTTGACAAGATGCACGTA
AAGTACGGCATCGTCGAGGTAGGCATGGGCGGCTCTACCGACGCGACAAACGTCATGCGCGAAAAGGCCGTCACC
ATCATCTCCCGCATCGGACTCGACCACCAAGAGTACCTCGGCGGCACCATCGAGGAGATTGCCCGCGTCAAGGCC
GGCATCATGCGTCAAGGGGTGCCGTGCATCGTCGACCCATCCAACCCGGACGAAGTCATGCGAGTCCTGTCCGAA
GAGGCCTACAACGCGGGCACGCAGATCACAATGGCGTCGCGGGCCGAGCCGCTGCTGGCCGGGCTCGACAGGGAC
CGCTTCCGGCTCGAGCCGTACGAGGAGCGGAATCTCCTGTGCGCCCTCCTGGCCTTTCAGAAGCTCTTCCCCAAC
CTCAAGATGGACGTCAACGAGCTCGTCTCGACCGACTCCCTGCTGCCGGGCCGGAAAGAGAAGATTAGCGTGACG
GGCCTTACCGGAGGCCTGCGCCGGCTGCCGATTCTGGTGGACGGGGCGCACAACATGCTGGGCTTCGAGGCGCTG
GCGGCCCACGTGCAAGGCAGCGTGCGGCAGGGGGACGAGCCGGTGACGTGGGTCATGGCCCTGTCGTCGAGCACG
TCGAAGCCGTTTGCCAAGATGATGGAGACGCTGGTCCAGCCACAGGACAGGCTCGCCTTTGTCGAATACGTGGCA
CAGGACGGCGACCCGCCCCCCACGGCGGCGGACCTCGGGCGCGACCTCGGGCGAATCATCCTCCGCGACGACCAG
AGCCAGCTGTACGACGGCGATCCGAGCGTCGGCGCCGGGGTGGTGTGGGCGTGCACCGAAGCCGGCAAAGGCCCC
GTGGTAGTGACGGGCAGCCTCTACATGATCCGCGACCTGTACCAGCTGGAGGGCGTGGAGCCGTCTCGCAAGATC
GGTACGATGCGTCCGGGGCCGTCACAGCTATGGCACTACACGCGGCTGGCGCAGGAGCGGACGCTGACGGCCGAC
GAGGAGAGCGAGTTCAAGCGGGCCCGCAGACACAACCACCTGTCCCCCCGGCGCAGCCACGTCTTCCGCCACGTC
CGGGACGGCGGCCAGCCGAAGCCGGTGCCGGTGCCGGACAGTGTCAGGCAGGCGCAGCGAACGGCGGCGTACCAC
AAGAAGCAGGCGGACGGGTGCAAGGTAGCCATTGAGAGCATGAGGGAGGACAGGAAGAAGTCGTCGTCGGACGGC
CATTTGGACAAGACGATGAAGGAGCTGCAGAGGAAACAACAGGAGCATTTGAGGGAGTACCGCAGAACTATGTTG
CGCGTCCGGGGCCGCAACCCGGACCCGAATAGAAAATTCACCAGTTACCAGGACATCTTCCGCAAGGTGAAAAAA
GGCGGCGACGGGCCCATAACCGCCCTCCTCCGCCGCTACAGCCTCCTCACCAAACTAGGCCAAGCCGTCGAAACA
GACGGCGAAGCCCAACTCCAACAGCAACGTGAAGCCGAGGAGCTGGAGAGGCAGCGGGAGGAGGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail