Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6348
Gene name
LocationContig_688:4532..5049
Strand-
Gene length (bp)517
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 7.4E-08 50 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P370|BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud20 PE=3 SV=1 9 85 2.0E-20
sp|Q08004|BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD20 PE=1 SV=1 11 85 3.0E-15
sp|Q553S1|ZN593_DICDI Zinc finger protein 593 homolog OS=Dictyostelium discoideum GN=DDB_G0275351 PE=3 SV=1 12 85 8.0E-13
sp|B0BLT0|ZN593_XENTR Zinc finger protein 593 OS=Xenopus tropicalis GN=znf593 PE=2 SV=1 5 85 8.0E-12
sp|Q9U239|ZN593_CAEEL Zinc finger protein 593 homolog OS=Caenorhabditis elegans GN=Y56A3A.18 PE=3 SV=1 2 85 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P370|BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud20 PE=3 SV=1 9 85 2.0E-20
sp|Q08004|BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD20 PE=1 SV=1 11 85 3.0E-15
sp|Q553S1|ZN593_DICDI Zinc finger protein 593 homolog OS=Dictyostelium discoideum GN=DDB_G0275351 PE=3 SV=1 12 85 8.0E-13
sp|B0BLT0|ZN593_XENTR Zinc finger protein 593 OS=Xenopus tropicalis GN=znf593 PE=2 SV=1 5 85 8.0E-12
sp|Q9U239|ZN593_CAEEL Zinc finger protein 593 homolog OS=Caenorhabditis elegans GN=Y56A3A.18 PE=3 SV=1 2 85 4.0E-09
sp|Q8SWF6|Z231_ENCCU Zinc finger C2H2 protein ECU02_0310 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0310 PE=3 SV=1 17 83 4.0E-09
sp|O00488|ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens GN=ZNF593 PE=1 SV=2 11 85 7.0E-08
sp|Q9DB42|ZN593_MOUSE Zinc finger protein 593 OS=Mus musculus GN=Znf593 PE=1 SV=2 11 85 1.0E-07
sp|Q9W3Y0|ZN593_DROME Zinc finger protein 593 homolog OS=Drosophila melanogaster GN=CG3224 PE=2 SV=1 43 85 8.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6676
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01776
Ophiocordyceps camponoti-rufipedis Ophun1|6348 (this protein)
Ophiocordyceps kimflemingae Ophio5|4976
Ophiocordyceps subramaniannii Hirsu2|5601

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6348
MGVSNKRTITKTRRKSRDVDQIKADLVSSRHLSEYKECKAAEDLPALGEHYCVECARWFDTALTLGAHRRGKPHK
RRLKQLREEPDPDPRRVMGAPVSVSAHGEGEGRAASTGMVWEPAADCASTTAFT*
Coding >Ophun1|6348
ATGGGAGTGAGCAACAAGCGCACGATTACGAAAACGAGGCGGAAATCAAGGGATGTGGACCAGATCAAGGCGGAC
CTCGTCTCTTCGCGACACCTCTCTGAGTACAAGGAGTGCAAGGCTGCGGAGGATCTTCCGGCCTTGGGGGAGCAT
TATTGCGTTGAGTGCGCGAGGTGGTTCGATACGGCCCTGACGCTGGGTGCTCATCGACGGGGGAAGCCTCATAAG
CGAAGGCTCAAGCAGTTGCGCGAGGAGCCTGATCCTGATCCTCGTCGAGTTATGGGGGCGCCCGTTTCGGTCTCG
GCTCATGGGGAGGGAGAGGGTCGCGCGGCTTCGACTGGGATGGTGTGGGAACCTGCTGCGGATTGCGCATCGACG
ACGGCCTTTACCTGA
Transcript >Ophun1|6348
ATGGGAGTGAGCAACAAGCGCACGATTACGAAAACGAGGCGGAAATCAAGGGATGTGGACCAGATCAAGGCGGAC
CTCGTCTCTTCGCGACACCTCTCTGAGTACAAGGAGTGCAAGGCTGCGGAGGATCTTCCGGCCTTGGGGGAGCAT
TATTGCGTTGAGTGCGCGAGGTGGTTCGATACGGCCCTGACGCTGGGTGCTCATCGACGGGGGAAGCCTCATAAG
CGAAGGCTCAAGCAGTTGCGCGAGGAGCCTGATCCTGATCCTCGTCGAGTTATGGGGGCGCCCGTTTCGGTCTCG
GCTCATGGGGAGGGAGAGGGTCGCGCGGCTTCGACTGGGATGGTGTGGGAACCTGCTGCGGATTGCGCATCGACG
ACGGCCTTTACCTGA
Gene >Ophun1|6348
ATGGGAGTGAGCAACAAGCGCACGATTACGAAAACGAGGCGGAAATCAAGGTACTGCCAGCTACGCAATCTCTCA
CCCTCGCAACGCAGCGGCAGGCAGGATTGACGCGGATCGCTTAGGGATGTGGACCAGATCAAGGCGGACCTCGTC
TCTTCGCGACACCTCTCTGAGTACAAGGAGTGCAAGGCTGCGGAGGATCTTCCGGCCTTGGGGGAGCATTATTGC
GTTGAGTGCGCGAGGTGGTTCGATACGGCCCTGACGCTGGGTGCTCATCGACGGGGGAAGCCTCATAAGCGAAGG
TCTGTCCTTTTGCGCGCGGCTATGGAAGTTTGGTTCCTGACGTTTTGGGAAATACAGGCTCAAGCAGTTGCGCGA
GGAGCCTGATCCTGATCCTCGTCGAGTTATGGGGGCGCCCGTTTCGGTCTCGGCTCATGGGGAGGGAGAGGGTCG
CGCGGCTTCGACTGGGATGGTGTGGGAACCTGCTGCGGATTGCGCATCGACGACGGCCTTTACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail