Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6347
Gene name
LocationContig_688:3829..4343
Strand+
Gene length (bp)514
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08653 DASH_Dam1 DASH complex subunit Dam1 3.1E-27 49 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C2T8|DAM1_YARLI DASH complex subunit DAM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DAM1 PE=3 SV=1 16 121 1.0E-14
sp|Q9HDZ6|DAM1_SCHPO DASH complex subunit dam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dam1 PE=1 SV=1 45 124 4.0E-12
sp|Q75EQ0|DAM1_ASHGO DASH complex subunit DAM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DAM1 PE=3 SV=2 40 103 4.0E-12
sp|Q6CVK1|DAM1_KLULA DASH complex subunit DAM1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DAM1 PE=3 SV=1 50 100 1.0E-11
sp|Q6BWK6|DAM1_DEBHA DASH complex subunit DAM1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DAM1 PE=3 SV=2 16 103 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C2T8|DAM1_YARLI DASH complex subunit DAM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DAM1 PE=3 SV=1 16 121 1.0E-14
sp|Q9HDZ6|DAM1_SCHPO DASH complex subunit dam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dam1 PE=1 SV=1 45 124 4.0E-12
sp|Q75EQ0|DAM1_ASHGO DASH complex subunit DAM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DAM1 PE=3 SV=2 40 103 4.0E-12
sp|Q6CVK1|DAM1_KLULA DASH complex subunit DAM1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DAM1 PE=3 SV=1 50 100 1.0E-11
sp|Q6BWK6|DAM1_DEBHA DASH complex subunit DAM1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DAM1 PE=3 SV=2 16 103 2.0E-11
sp|Q6FLB2|DAM1_CANGA DASH complex subunit DAM1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DAM1 PE=3 SV=1 23 103 1.0E-10
sp|P53267|DAM1_YEAST DASH complex subunit DAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAM1 PE=1 SV=2 50 144 6.0E-10
sp|Q5APC8|DAM1_CANAL DASH complex subunit DAM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DAM1 PE=3 SV=1 52 108 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0072686 mitotic spindle Yes
GO:0042729 DASH complex Yes
GO:0008608 attachment of spindle microtubules to kinetochore Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0005819 spindle No
GO:0022402 cell cycle process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0140513 nuclear protein-containing complex No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6347
MTTEAREPKRSNSRTRPNTPLRASSRSSLRDSARGPDDNDGSLPLNVFEPAFAELSDAMADLEANLMHFQLMHES
LARFSESFASFLYGLNMNAFCVDFPEGPITESFRRDRQPDRAQARAPPRQEPEPETTFMYALPPSQRGCHLPPV*
Coding >Ophun1|6347
ATGACAACAGAAGCCCGCGAACCCAAGCGATCCAACTCGCGAACCCGCCCCAACACCCCTCTCCGCGCATCCTCC
CGCTCCTCACTGCGCGACTCCGCCCGCGGCCCAGACGACAACGATGGCTCCCTCCCACTCAACGTCTTCGAGCCG
GCCTTTGCAGAGCTGTCGGATGCCATGGCCGATCTGGAGGCCAACCTGATGCACTTTCAGCTCATGCACGAGAGT
CTGGCTCGGTTTAGCGAGTCGTTTGCCAGCTTTCTCTATGGGCTTAATATGAATGCCTTTTGTGTTGATTTTCCC
GAGGGTCCCATCACCGAGTCCTTCCGCAGAGATCGGCAACCAGACAGAGCCCAAGCTCGTGCCCCTCCGCGACAG
GAGCCAGAGCCGGAAACCACCTTTATGTACGCGCTACCCCCCAGTCAAAGAGGCTGTCATCTGCCGCCCGTCTGA
Transcript >Ophun1|6347
ATGACAACAGAAGCCCGCGAACCCAAGCGATCCAACTCGCGAACCCGCCCCAACACCCCTCTCCGCGCATCCTCC
CGCTCCTCACTGCGCGACTCCGCCCGCGGCCCAGACGACAACGATGGCTCCCTCCCACTCAACGTCTTCGAGCCG
GCCTTTGCAGAGCTGTCGGATGCCATGGCCGATCTGGAGGCCAACCTGATGCACTTTCAGCTCATGCACGAGAGT
CTGGCTCGGTTTAGCGAGTCGTTTGCCAGCTTTCTCTATGGGCTTAATATGAATGCCTTTTGTGTTGATTTTCCC
GAGGGTCCCATCACCGAGTCCTTCCGCAGAGATCGGCAACCAGACAGAGCCCAAGCTCGTGCCCCTCCGCGACAG
GAGCCAGAGCCGGAAACCACCTTTATGTACGCGCTACCCCCCAGTCAAAGAGGCTGTCATCTGCCGCCCGTCTGA
Gene >Ophun1|6347
ATGACAACAGAAGCCCGCGAACCCAAGCGATCCAACTCGCGAACCCGCCCCAACACCCCTCTCCGCGCATCCTCC
CGCTCCTCACTGCGCGACTCCGCCCGCGGCCCAGACGACAACGATGGCTCCCTCCCACTCAACGTCTTCGAGCCG
GCCTTTGCAGAGCTGTCGGATGCCATGGCCGATCTGGAGGCCAACCTGATGCACTTTCAGCTCATGCACGAGAGT
CTGGCTCGGTTTAGCGAGTCGTTTGCCAGCTTTCTCTATGGGCTTAATATGAATGCCTTTTGTGTTGATTTTCCC
GAGGTGTGTTTGACGCGAAGCCCAACTAGCCAGCCGTCCACGAAGCTCACAATTCTTCGATGTACAGGGTCCCAT
CACCGAGTCCTTCCGCAGAGATCGGCAACCAGACAGAGCCCAAGCTCGTGCCCCTCCGCGACAGGAGCCAGAGCC
GGAAACCACCTTTATGTACGCGCTACCCCCCAGTCAAAGAGGCTGTCATCTGCCGCCCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail