Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6337
Gene name
LocationContig_685:5222..6773
Strand+
Gene length (bp)1551
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.1E-41 1 259
PF01250 Ribosomal_S6 Ribosomal protein S6 1.1E-15 259 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7YVD7|NDUF6_BOVIN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Bos taurus GN=NDUFAF6 PE=2 SV=1 1 193 7.0E-31
sp|D3ZN43|NDUF6_RAT NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Rattus norvegicus GN=Ndufaf6 PE=3 SV=1 1 254 1.0E-29
sp|Q330K2|NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens GN=NDUFAF6 PE=1 SV=2 1 193 5.0E-29
sp|A2AIL4|NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus GN=Ndufaf6 PE=1 SV=1 1 254 7.0E-29
sp|Q9VYS5|NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster GN=sicily PE=2 SV=1 1 253 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7YVD7|NDUF6_BOVIN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Bos taurus GN=NDUFAF6 PE=2 SV=1 1 193 7.0E-31
sp|D3ZN43|NDUF6_RAT NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Rattus norvegicus GN=Ndufaf6 PE=3 SV=1 1 254 1.0E-29
sp|Q330K2|NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens GN=NDUFAF6 PE=1 SV=2 1 193 5.0E-29
sp|A2AIL4|NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus GN=Ndufaf6 PE=1 SV=1 1 254 7.0E-29
sp|Q9VYS5|NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster GN=sicily PE=2 SV=1 1 253 3.0E-22
sp|Q54E48|NDUF6_DICDI NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Dictyostelium discoideum GN=DDB_G0291852 PE=3 SV=1 1 197 1.0E-15
sp|P28778|RT06_YEAST 37S ribosomal protein MRP17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP17 PE=1 SV=1 265 344 3.0E-09
sp|Q9UT82|RT06_SCHPO 37S ribosomal protein MRP17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp17 PE=3 SV=2 257 346 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0009058 biosynthetic process Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0003676 nucleic acid binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0003723 RNA binding No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4501
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5320
Ophiocordyceps australis map64 (Brazil) OphauB2|3798
Ophiocordyceps camponoti-floridani Ophcf2|01703
Ophiocordyceps camponoti-rufipedis Ophun1|6337 (this protein)
Ophiocordyceps kimflemingae Ophio5|4294
Ophiocordyceps subramaniannii Hirsu2|9385

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6337
MRLKFWQDSLDRTFSDHPPREPICILLHQALRQLELRAGGDASRQSIKFWVSRLVRTRQRYMDNRPFPNLAALED
YAENTYSTLMYATLAFLPLRSTQLDHLASHMGKANGIVATLRGIPYLSSPPQPIQTPKGASAPSPRTPVLLLPLD
IMSTAGVKEEAVFRKGPSAPGLQDAVFKVATRAHDHLLTAREMLARLTRGEDAGHEYEHGGEEDHVYGGGDDDVR
MELRRCFGVFLEAVPAGVYLDALEKVNFDPWAVRPGKVEEVKTIVKTVGTAILENGGVIRGLCNWGVYALPRPIS
IHQMQHAYGHHFVLRYDSSTGVHRKVRQILRAEPRMLRAVHAKLGDNTLPVLARFGAPAWIPQSVTEL*
Coding >Ophun1|6337
ATGCGCCTCAAGTTCTGGCAAGACTCCCTCGACCGCACCTTTTCCGACCACCCGCCCCGCGAACCCATCTGCATC
CTCCTCCACCAAGCCCTCCGCCAACTCGAGCTCAGAGCCGGAGGTGACGCCTCCAGACAATCCATCAAGTTCTGG
GTCTCGCGTCTCGTCAGGACCAGGCAGCGGTACATGGACAACCGGCCGTTTCCGAACCTGGCCGCGTTGGAGGAC
TATGCCGAGAATACCTACTCGACTCTCATGTACGCCACTCTCGCCTTTCTACCCCTGCGGTCTACACAACTGGAC
CACCTAGCCAGCCACATGGGCAAAGCCAACGGCATCGTCGCCACCCTCCGGGGAATCCCCTACCTCTCCTCCCCC
CCCCAACCAATCCAAACCCCCAAAGGCGCCTCAGCCCCCAGTCCGCGCACCCCAGTCCTCCTCCTCCCCCTCGAC
ATCATGTCCACCGCCGGCGTCAAAGAAGAAGCCGTGTTCCGCAAAGGGCCCAGCGCACCAGGCCTCCAAGACGCC
GTCTTCAAAGTCGCCACCCGCGCGCACGACCACCTCCTCACCGCGAGGGAGATGCTGGCCCGCCTGACGCGCGGT
GAGGACGCTGGCCACGAGTATGAGCACGGGGGGGAGGAGGATCACGTCTACGGCGGGGGTGACGACGATGTGCGG
ATGGAGTTGAGGCGGTGCTTTGGCGTGTTTTTGGAGGCTGTTCCTGCGGGGGTGTATCTTGATGCTCTCGAAAAG
GTCAACTTTGATCCGTGGGCTGTCCGACCGGGAAAAGTCGAAGAAGTAAAGACCATCGTCAAAACAGTCGGAACC
GCCATCCTCGAAAACGGCGGGGTGATACGCGGGCTGTGCAACTGGGGCGTCTACGCGCTTCCCAGACCCATCTCC
ATCCATCAGATGCAGCACGCGTACGGACATCACTTTGTGCTCCGCTATGATTCTTCGACGGGGGTTCATCGCAAG
GTGCGGCAGATTTTGAGGGCTGAGCCTAGGATGTTGAGGGCGGTGCATGCCAAGCTGGGGGATAATACCCTGCCT
GTTTTGGCGAGGTTTGGGGCGCCGGCGTGGATTCCTCAGTCGGTGACGGAGCTTTAG
Transcript >Ophun1|6337
ATGCGCCTCAAGTTCTGGCAAGACTCCCTCGACCGCACCTTTTCCGACCACCCGCCCCGCGAACCCATCTGCATC
CTCCTCCACCAAGCCCTCCGCCAACTCGAGCTCAGAGCCGGAGGTGACGCCTCCAGACAATCCATCAAGTTCTGG
GTCTCGCGTCTCGTCAGGACCAGGCAGCGGTACATGGACAACCGGCCGTTTCCGAACCTGGCCGCGTTGGAGGAC
TATGCCGAGAATACCTACTCGACTCTCATGTACGCCACTCTCGCCTTTCTACCCCTGCGGTCTACACAACTGGAC
CACCTAGCCAGCCACATGGGCAAAGCCAACGGCATCGTCGCCACCCTCCGGGGAATCCCCTACCTCTCCTCCCCC
CCCCAACCAATCCAAACCCCCAAAGGCGCCTCAGCCCCCAGTCCGCGCACCCCAGTCCTCCTCCTCCCCCTCGAC
ATCATGTCCACCGCCGGCGTCAAAGAAGAAGCCGTGTTCCGCAAAGGGCCCAGCGCACCAGGCCTCCAAGACGCC
GTCTTCAAAGTCGCCACCCGCGCGCACGACCACCTCCTCACCGCGAGGGAGATGCTGGCCCGCCTGACGCGCGGT
GAGGACGCTGGCCACGAGTATGAGCACGGGGGGGAGGAGGATCACGTCTACGGCGGGGGTGACGACGATGTGCGG
ATGGAGTTGAGGCGGTGCTTTGGCGTGTTTTTGGAGGCTGTTCCTGCGGGGGTGTATCTTGATGCTCTCGAAAAG
GTCAACTTTGATCCGTGGGCTGTCCGACCGGGAAAAGTCGAAGAAGTAAAGACCATCGTCAAAACAGTCGGAACC
GCCATCCTCGAAAACGGCGGGGTGATACGCGGGCTGTGCAACTGGGGCGTCTACGCGCTTCCCAGACCCATCTCC
ATCCATCAGATGCAGCACGCGTACGGACATCACTTTGTGCTCCGCTATGATTCTTCGACGGGGGTTCATCGCAAG
GTGCGGCAGATTTTGAGGGCTGAGCCTAGGATGTTGAGGGCGGTGCATGCCAAGCTGGGGGATAATACCCTGCCT
GTTTTGGCGAGGTTTGGGGCGCCGGCGTGGATTCCTCAGTCGGTGACGGAGCTTTAG
Gene >Ophun1|6337
ATGCGCCTCAAGTTCTGGCAAGACTCCCTCGACCGCACCTTTTCCGACCACCCGCCCCGCGAACCCATCTGCATC
CTCCTCCACCAAGCCCTCCGCCAACTCGAGCTCAGAGCCGGAGGTGACGCCTCCAGACAATCCATCAAGTTCTGG
GTCTCGCGTCTCGTCAGGACCAGGCAGCGGTACATGGACAACCGGCCGTTTCCGAACCTGGCCGCGTTGGAGGAC
TATGCCGAGAATACCTACTCGACTCTCATGTACGCCACTCTCGCCTTTCTACCCCTGCGGTCTACACAACTGGAC
CACCTAGCCAGCCACATGGGCAAAGCCAACGGCATCGTCGCCACCCTCCGGGGAATCCCCTACCTCTCCTCCCCC
CCCCAACCAATCCAAACCCCCAAAGGCGCCTCAGCCCCCAGTCCGCGCACCCCAGTCCTCCTCCTCCCCCTCGAC
ATCATGTCCACCGCCGGCGTCAAAGAAGAAGCCGTGTTCCGCAAAGGGCCCAGCGCACCAGGCCTCCAAGACGCC
GTCTTCAAAGTCGCCACCCGCGCGCACGACCACCTCCTCACCGCGAGGGAGATGCTGGCCCGCCTGACGCGCGGT
GAGGACGCTGGCCACGAGTATGAGCACGGGGGGGAGGAGGATCACGTCTACGGCGGGGGTGACGACGATGTGCGG
ATGGAGTTGAGGCGGTGCTTTGGCGTGTTTTTGGAGGCTGTTCCTGCGGGGGTGTATCTTGATGCTCTCGAAAAG
GTCAACTTTGATCCGTGGGCTGTAGGGAGTGCGGGATGGAGGCTTCCGTGGAGGATATGGAGGGCTCTATCTAAG
CGGGAGCTGTGATGTGTGTGGAAGAAGGGCTCAATGTAAGGGGGAGCTGTCGGAAGAATGAACAAAGTACGGCAA
CTGGTATAGAAGGTCTTTTACAAGACAAGAGCTTTACAAATAAGAATAGCTGAAACCAGATATTACGACTCCTCC
AATCAGCAAAGCGACATCCCGACAACTGCATCACCACCCGGCAAAACCTCGGCCCACCCTCAAAACCAATCCTTC
CCCCAACCTCACCTCCAGAGTCCACCCAAAATGCTCTACGAAACAATCGGCATCGTCCGTCTCTCCCTCCCCCCT
CATCAATCCCACTAACAACCCCCCCAGGTCCGACCGGGAAAAGTCGAAGAAGTAAAGACGTACGCCCTCCTCACA
CCCCTCGCAACTCCAAAAGACAACAACAGCTAATGATCCCCCCCCAGCATCGTCAAAACAGTCGGAACCGCCATC
CTCGAAAACGGCGGGGTGATACGCGGGCTGTGCAACTGGGGCGTCTACGCGCTTCCCAGACCCATCTCCATCCAT
CAGATGCAGCACGCGTACGGACATCACTTTGTGCTCCGCTATGATTCTTCGACGGGGGTTCATCGCAAGGTGCGG
CAGATTTTGAGGGCTGAGCCTAGGATGTTGAGGGCGGTGCATGCCAAGCTGGGGGATAATACCCTGCCTGTTTTG
GCGAGGTTTGGGGCGCCGGCGTGGATTCCTCAGTCGGTGACGGAGCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail