Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6333
Gene name
LocationContig_684:2005..3121
Strand+
Gene length (bp)1116
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 2.5E-33 8 283

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13729|PUN1_SCHPO SUR7 family protein pun1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pun1 PE=3 SV=1 7 287 4.0E-07

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 189 211 22
3 218 240 22
4 267 289 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6333
MAVGRFICVAIPLILTVAAIITALVATLAGVTHQGLPLFSVNATGLSLNANNLVDLASKVNVRQLRKEIVDKIPK
EIADKIPPDLAKNIPPELAGKINADNLPQLLANNVTASTLGLPPVTEVSLWGYCQLDRDGGSRNCTKPQFDWAST
SLNSTTTILDSLSAAAGSSTRLPDEVRKALQAFRTITKWTEIAFVVALIALGLELLVGIFATCSRVASCLTWVIA
SIAAVLMGIAAGLATATASIVTGAVDAAGRNTGLDATVGKKFFATVWIAFAFAAAAAILWLLTICCCKPEHRSSS
SGFRSVNRRRDDDRENLVSGGKGYAPVVNEHGASGGLPQGQPGQAFSQYPPRYPSNTARPDMAYEPYSHRA*
Coding >Ophun1|6333
ATGGCTGTCGGCCGCTTCATCTGCGTCGCCATACCTCTGATCCTCACCGTCGCCGCCATCATCACTGCGCTCGTG
GCCACTCTCGCGGGTGTAACGCACCAAGGCCTCCCCCTCTTCAGCGTCAACGCAACGGGCCTTTCATTGAACGCA
AACAACCTTGTCGATCTCGCCAGCAAGGTCAATGTCCGTCAGCTACGCAAAGAGATTGTCGACAAGATCCCCAAG
GAGATTGCCGACAAGATCCCACCTGATCTGGCAAAAAATATCCCTCCTGAGCTGGCAGGCAAGATCAACGCGGAT
AATCTCCCTCAGCTGCTCGCAAACAACGTCACAGCTTCCACCCTGGGTCTTCCCCCAGTTACGGAGGTGTCTCTC
TGGGGTTACTGTCAGCTCGACCGCGACGGTGGCTCTCGCAACTGTACCAAGCCTCAATTTGACTGGGCTTCCACA
TCGCTCAACAGCACCACCACGATACTAGATTCACTGTCGGCCGCCGCGGGCTCTTCGACTCGACTGCCCGATGAG
GTGCGAAAGGCGCTACAAGCGTTCCGGACCATCACCAAATGGACCGAGATAGCCTTTGTCGTCGCCCTCATCGCT
CTCGGCCTCGAGTTGCTCGTTGGCATCTTCGCGACCTGCTCGCGTGTGGCCTCGTGTCTGACCTGGGTCATCGCC
TCTATTGCCGCCGTCCTGATGGGAATAGCGGCCGGTCTCGCTACGGCCACGGCCAGCATCGTGACTGGAGCCGTC
GACGCAGCGGGCCGTAACACGGGTCTCGACGCCACTGTCGGAAAGAAGTTCTTCGCAACAGTGTGGATCGCCTTC
GCCTTCGCCGCCGCAGCCGCCATCCTCTGGCTCCTGACCATCTGCTGCTGCAAACCCGAGCATCGAAGCAGCAGC
AGCGGTTTCAGGTCCGTCAACAGGCGCCGCGACGATGACCGCGAGAACCTGGTTTCCGGTGGCAAAGGCTACGCG
CCCGTCGTCAACGAGCATGGCGCCTCGGGCGGGCTGCCACAGGGTCAGCCCGGACAAGCCTTCTCACAATATCCT
CCCCGCTACCCAAGCAACACCGCCCGTCCAGACATGGCCTACGAGCCATACTCACATCGGGCGTAG
Transcript >Ophun1|6333
ATGGCTGTCGGCCGCTTCATCTGCGTCGCCATACCTCTGATCCTCACCGTCGCCGCCATCATCACTGCGCTCGTG
GCCACTCTCGCGGGTGTAACGCACCAAGGCCTCCCCCTCTTCAGCGTCAACGCAACGGGCCTTTCATTGAACGCA
AACAACCTTGTCGATCTCGCCAGCAAGGTCAATGTCCGTCAGCTACGCAAAGAGATTGTCGACAAGATCCCCAAG
GAGATTGCCGACAAGATCCCACCTGATCTGGCAAAAAATATCCCTCCTGAGCTGGCAGGCAAGATCAACGCGGAT
AATCTCCCTCAGCTGCTCGCAAACAACGTCACAGCTTCCACCCTGGGTCTTCCCCCAGTTACGGAGGTGTCTCTC
TGGGGTTACTGTCAGCTCGACCGCGACGGTGGCTCTCGCAACTGTACCAAGCCTCAATTTGACTGGGCTTCCACA
TCGCTCAACAGCACCACCACGATACTAGATTCACTGTCGGCCGCCGCGGGCTCTTCGACTCGACTGCCCGATGAG
GTGCGAAAGGCGCTACAAGCGTTCCGGACCATCACCAAATGGACCGAGATAGCCTTTGTCGTCGCCCTCATCGCT
CTCGGCCTCGAGTTGCTCGTTGGCATCTTCGCGACCTGCTCGCGTGTGGCCTCGTGTCTGACCTGGGTCATCGCC
TCTATTGCCGCCGTCCTGATGGGAATAGCGGCCGGTCTCGCTACGGCCACGGCCAGCATCGTGACTGGAGCCGTC
GACGCAGCGGGCCGTAACACGGGTCTCGACGCCACTGTCGGAAAGAAGTTCTTCGCAACAGTGTGGATCGCCTTC
GCCTTCGCCGCCGCAGCCGCCATCCTCTGGCTCCTGACCATCTGCTGCTGCAAACCCGAGCATCGAAGCAGCAGC
AGCGGTTTCAGGTCCGTCAACAGGCGCCGCGACGATGACCGCGAGAACCTGGTTTCCGGTGGCAAAGGCTACGCG
CCCGTCGTCAACGAGCATGGCGCCTCGGGCGGGCTGCCACAGGGTCAGCCCGGACAAGCCTTCTCACAATATCCT
CCCCGCTACCCAAGCAACACCGCCCGTCCAGACATGGCCTACGAGCCATACTCACATCGGGCGTAG
Gene >Ophun1|6333
ATGGCTGTCGGCCGCTTCATCTGCGTCGCCATACCTCTGATCCTCACCGTCGCCGCCATCATCACTGCGCTCGTG
GCCACTCTCGCGGGTGTAACGCACCAAGGCCTCCCCCTCTTCAGCGTCAACGCAACGGGCCTTTCATTGAACGCA
AACAACCTTGTCGATCTCGCCAGCAAGGTCAATGTCCGTCAGCTACGCAAAGAGATTGTCGACAAGATCCCCAAG
GAGATTGCCGACAAGATCCCACCTGATCTGGCAAAAAATATCCCTCCTGAGCTGGCAGGCAAGATCAACGCGGAT
AATCTCCCTCAGCTGCTCGCAAACAACGTCACAGCTTCCACCCTGGGTCTTCCCCCAGTTACGGAGGTGTCTCTC
TGGGGTTACTGTCAGCTCGACCGCGACGGTGGCTCTCGCAACTGTACCAAGCCTCAATTTGACTGGGCTTCCACA
TCGCTCAACAGCACCACCACGATACTAGATTCACTGTCGGCCGCCGCGGGCTCTTCGACTCGACTGCCCGATGAG
GTGCGAAAGGCGCTACAAGCGTTCCGGACCATCACCAAATGGACCGAGATAGCCTTTGTCGTCGCCCTCATCGCT
CTCGGCCTCGAGTTGCTCGTTGGCATCTTCGCGACCTGCTCGCGTGTGGCCTCGTGTCTGACCTGGGTCATCGCC
TCTATTGCCGCCGTCCTGATGGGAATAGCGGCCGGTCTCGCTACGGCCACGGCCAGCATCGTGACTGGAGCCGTC
GACGCAGCGGGCCGTAACACGGGTCTCGACGCCACTGTCGGAAAGAAGTTCTTCGCAACAGTGTGGATCGCCTTC
GCCTTCGCCGCCGCAGCCGCCATCCTCTGGCTCCTGACCATCTGCTGCTGCAAACCCGAGCATCGAAGCAGCAGC
AGCGGTTTCAGGTCCGTCAACAGGCGCCGCGACGATGACCGCGAGAACCTGGTTTCCGGTGGCAAAGGCTACGCG
CCCGTCGTCAACGAGCATGGCGCCTCGGGCGGGCTGCCACAGGGTCAGCCCGGACAAGCCTTCTCACAATATCCT
CCCCGCTACCCAAGCAACACCGCCCGTCCAGACATGGCCTACGAGCCATACTCACATCGGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail