Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6332
Gene name
LocationContig_683:7119..8916
Strand-
Gene length (bp)1797
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02146 SIR2 Sir2 family 6.5E-25 114 328

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BE04|HST4_EMENI NAD-dependent protein deacetylase hst4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1226 PE=3 SV=1 60 391 1.0E-122
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 92 373 2.0E-88
sp|P53688|HST4_YEAST NAD-dependent histone deacetylase HST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST4 PE=1 SV=1 102 383 5.0E-66
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 96 439 1.0E-48
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 85 384 8.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BE04|HST4_EMENI NAD-dependent protein deacetylase hst4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1226 PE=3 SV=1 60 391 1.0E-122
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 92 373 2.0E-88
sp|P53688|HST4_YEAST NAD-dependent histone deacetylase HST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST4 PE=1 SV=1 102 383 5.0E-66
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 96 439 1.0E-48
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 85 384 8.0E-40
sp|Q9VK34|SIR2_DROME NAD-dependent histone deacetylase Sir2 OS=Drosophila melanogaster GN=Sir2 PE=1 SV=1 99 328 1.0E-19
sp|Q21921|SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans GN=sir-2.1 PE=1 SV=1 100 328 3.0E-19
sp|Q60L58|SIR2_CAEBR NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis briggsae GN=sir-2.1 PE=3 SV=1 103 328 4.0E-19
sp|P06700|SIR2_YEAST NAD-dependent histone deacetylase SIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIR2 PE=1 SV=1 94 383 3.0E-18
sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 93 383 6.0E-18
sp|Q757M7|SIR2_ASHGO NAD-dependent histone deacetylase SIR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIR2 PE=3 SV=1 94 383 1.0E-17
sp|P53685|HST1_YEAST NAD-dependent protein deacetylase HST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST1 PE=1 SV=1 93 383 3.0E-17
sp|P33294|SIR2_KLULA NAD-dependent histone deacetylase SIR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SIR2 PE=3 SV=2 93 383 4.0E-17
sp|C8V3W5|HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10449 PE=3 SV=1 103 328 7.0E-17
sp|Q96EB6|SIR1_HUMAN NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens GN=SIRT1 PE=1 SV=2 96 328 1.0E-15
sp|Q5AQ47|HST1_CANAL NAD-dependent protein deacetylase HST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST1 PE=3 SV=1 65 383 2.0E-15
sp|Q923E4|SIR1_MOUSE NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus GN=Sirt1 PE=1 SV=2 96 328 3.0E-15
sp|Q81BT4|NPD_BACCR NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cobB PE=3 SV=1 96 381 1.0E-14
sp|Q9I4E1|NPD2_PSEAE NAD-dependent protein deacylase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB2 PE=3 SV=1 102 379 2.0E-14
sp|Q67KQ0|NPD_SYMTH NAD-dependent protein deacetylase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cobB PE=3 SV=1 95 328 2.0E-14
sp|Q5AW69|HST21_EMENI NAD-dependent protein deacetylase hst2-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7461 PE=3 SV=1 107 328 2.0E-14
sp|Q735N7|NPD_BACC1 NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cobB PE=3 SV=1 96 384 3.0E-14
sp|Q81NT6|NPD_BACAN NAD-dependent protein deacetylase OS=Bacillus anthracis GN=cobB PE=3 SV=1 96 381 3.0E-14
sp|Q88BY5|NPD_PSEPK NAD-dependent protein deacylase OS=Pseudomonas putida (strain KT2440) GN=cobB PE=3 SV=1 95 325 6.0E-14
sp|Q6HH09|NPD_BACHK NAD-dependent protein deacetylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cobB PE=3 SV=1 103 381 6.0E-14
sp|Q639M6|NPD_BACCZ NAD-dependent protein deacetylase OS=Bacillus cereus (strain ZK / E33L) GN=cobB PE=3 SV=1 103 328 2.0E-13
sp|Q899G3|NPD_CLOTE NAD-dependent protein deacetylase OS=Clostridium tetani (strain Massachusetts / E88) GN=cobB PE=3 SV=1 97 328 2.0E-13
sp|O59923|SIR2_CANAL NAD-dependent histone deacetylase SIR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIR2 PE=1 SV=2 94 396 3.0E-13
sp|O94640|SIR2_SCHPO NAD-dependent histone deacetylase sir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir2 PE=1 SV=2 96 335 4.0E-13
sp|Q54GV7|SIR2D_DICDI NAD-dependent deacetylase sir2D OS=Dictyostelium discoideum GN=sir2D PE=2 SV=1 96 328 7.0E-13
sp|Q839C6|NPD_ENTFA NAD-dependent protein deacetylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cobB PE=3 SV=1 100 328 8.0E-13
sp|A8MBU4|NPD_CALMQ NAD-dependent protein deacetylase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=cobB PE=3 SV=1 103 383 2.0E-12
sp|Q25337|SIR2_LEIMA NAD-dependent protein deacetylase SIR2rp1 OS=Leishmania major GN=SIR2rp1 PE=2 SV=2 96 328 3.0E-12
sp|Q5A985|HST2_CANAL NAD-dependent protein deacetylase HST2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST2 PE=3 SV=1 96 226 3.0E-12
sp|Q5KZE8|NPD2_GEOKA NAD-dependent protein deacetylase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB2 PE=3 SV=1 95 267 4.0E-12
sp|Q8R984|NPD2_CALS4 NAD-dependent protein deacetylase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB2 PE=3 SV=1 103 328 5.0E-12
sp|Q54P49|SIR2C_DICDI NAD-dependent deacetylase sir2C OS=Dictyostelium discoideum GN=sir2C PE=2 SV=1 107 328 9.0E-12
sp|Q8R9N6|NPD1_CALS4 NAD-dependent protein deacylase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB1 PE=3 SV=1 110 328 9.0E-12
sp|Q57V41|SIR2_TRYB2 NAD-dependent protein deacetylase SIR2rp1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp1 PE=1 SV=1 108 328 1.0E-11
sp|Q9Y6E7|SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens GN=SIRT4 PE=1 SV=1 96 384 2.0E-11
sp|Q5RJQ4|SIR2_RAT NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus GN=Sirt2 PE=1 SV=1 92 328 2.0E-11
sp|Q5HM33|NPD_STAEQ NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cobB PE=3 SV=1 96 338 2.0E-11
sp|Q68FX9|SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus GN=Sirt5 PE=2 SV=1 105 325 2.0E-11
sp|Q9WYW0|NPD_THEMA NAD-dependent protein deacetylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cobB PE=1 SV=1 96 328 2.0E-11
sp|O07595|NPD_BACSU NAD-dependent protein deacetylase OS=Bacillus subtilis (strain 168) GN=cobB PE=3 SV=1 96 381 3.0E-11
sp|Q8VDQ8|SIR2_MOUSE NAD-dependent protein deacetylase sirtuin-2 OS=Mus musculus GN=Sirt2 PE=1 SV=2 92 328 4.0E-11
sp|Q88ZA0|NPD_LACPL NAD-dependent protein deacetylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cobB PE=3 SV=1 101 328 4.0E-11
sp|Q885X7|NPD2_PSESM NAD-dependent protein deacylase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB2 PE=3 SV=1 101 383 4.0E-11
sp|C6A243|NPD_THESM NAD-dependent protein deacylase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=cobB PE=3 SV=1 109 328 4.0E-11
sp|Q8CJM9|NPD2_STRCO NAD-dependent protein deacetylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB2 PE=3 SV=1 103 280 5.0E-11
sp|Q6A5T5|NPD_PROAC NAD-dependent protein deacetylase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=cobB PE=3 SV=1 97 328 6.0E-11
sp|Q9USN7|HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst2 PE=3 SV=1 95 328 7.0E-11
sp|Q5L014|NPD1_GEOKA NAD-dependent protein deacetylase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB1 PE=3 SV=1 101 328 1.0E-10
sp|Q9I7I7|SIRT2_DROME NAD-dependent protein deacetylase Sirt2 OS=Drosophila melanogaster GN=Sirt2 PE=3 SV=1 107 328 1.0E-10
sp|Q73KE1|NPD_TREDE NAD-dependent protein deacetylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cobB PE=3 SV=1 98 328 1.0E-10
sp|Q8FUC8|NPD1_COREF NAD-dependent protein deacetylase 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB1 PE=3 SV=2 103 337 2.0E-10
sp|O30124|NPD2_ARCFU NAD-dependent protein deacylase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB2 PE=1 SV=1 95 328 2.0E-10
sp|Q71W25|NPD_LISMF NAD-dependent protein deacetylase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cobB PE=3 SV=1 96 328 2.0E-10
sp|Q8CNF4|NPD_STAES NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cobB PE=3 SV=1 96 338 2.0E-10
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 107 328 3.0E-10
sp|O28597|NPD1_ARCFU NAD-dependent protein deacylase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB1 PE=1 SV=1 97 328 3.0E-10
sp|B5YJW3|NPD_THEYD NAD-dependent protein deacetylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cobB PE=3 SV=1 110 328 3.0E-10
sp|Q97MB4|NPD_CLOAB NAD-dependent protein deacetylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cobB PE=3 SV=1 109 328 3.0E-10
sp|Q5WKC8|NPD_BACSK NAD-dependent protein deacetylase OS=Bacillus clausii (strain KSM-K16) GN=cobB PE=3 SV=1 101 328 4.0E-10
sp|Q8TWG0|NPD_METKA NAD-dependent protein deacylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=cobB PE=3 SV=1 107 328 6.0E-10
sp|Q8ZT00|NPD2_PYRAE NAD-dependent protein deacylase 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB2 PE=3 SV=1 103 325 6.0E-10
sp|Q7ZVK3|SIR2_DANRE NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio GN=sirt2 PE=2 SV=1 107 328 9.0E-10
sp|Q89LY4|NPD1_BRADU NAD-dependent protein deacetylase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB1 PE=3 SV=1 96 328 1.0E-09
sp|Q8Y3U2|NPD_LISMO NAD-dependent protein deacetylase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cobB PE=3 SV=1 96 328 1.0E-09
sp|Q8XNS6|NPD_CLOPE NAD-dependent protein deacetylase OS=Clostridium perfringens (strain 13 / Type A) GN=cobB PE=3 SV=1 96 328 2.0E-09
sp|P53686|HST2_YEAST NAD-dependent protein deacetylase HST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST2 PE=1 SV=1 108 328 2.0E-09
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 96 384 3.0E-09
sp|Q1JQC6|SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus GN=SIRT4 PE=2 SV=1 96 384 3.0E-09
sp|F7EZ75|SIR5_MACMU NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Macaca mulatta GN=SIRT5 PE=3 SV=1 107 325 3.0E-09
sp|Q7P1B9|NPD_CHRVO NAD-dependent protein deacetylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cobB PE=3 SV=1 95 328 3.0E-09
sp|F7DKV7|SIR5_XENTR NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Xenopus tropicalis GN=sirt5 PE=3 SV=1 95 325 6.0E-09
sp|Q9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens GN=SIRT5 PE=1 SV=2 107 325 6.0E-09
sp|Q9KEE5|NPD_BACHD NAD-dependent protein deacetylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cobB PE=3 SV=1 99 328 6.0E-09
sp|Q8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens GN=SIRT2 PE=1 SV=2 92 208 8.0E-09
sp|Q4R834|SIR2_MACFA NAD-dependent protein deacetylase sirtuin-2 OS=Macaca fascicularis GN=SIRT2 PE=2 SV=1 92 208 8.0E-09
sp|Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens GN=SIRT3 PE=1 SV=2 104 244 1.0E-08
sp|Q5JG47|NPD_THEKO NAD-dependent protein deacylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cobB PE=3 SV=1 95 325 1.0E-08
sp|Q5RBF1|SIR2_PONAB NAD-dependent protein deacetylase sirtuin-2 OS=Pongo abelii GN=SIRT2 PE=2 SV=1 107 208 1.0E-08
sp|Q5R6G3|SIR5_PONAB NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Pongo abelii GN=SIRT5 PE=2 SV=1 107 325 1.0E-08
sp|Q974M6|NPD_SULTO NAD-dependent protein deacetylase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cobB PE=3 SV=2 110 378 2.0E-08
sp|E9GD30|SIR5_DAPPU NAD-dependent protein deacylase OS=Daphnia pulex GN=DAPPUDRAFT_195469 PE=3 SV=1 103 325 2.0E-08
sp|Q5HZN8|SIR5A_XENLA NAD-dependent protein deacylase sirtuin-5A, mitochondrial OS=Xenopus laevis GN=sirt5-a PE=2 SV=1 95 325 3.0E-08
sp|Q584D5|SIR5_TRYB2 NAD-dependent protein deacylase SIR2rp3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp3 PE=3 SV=1 104 364 3.0E-08
sp|P66816|NPD_STAAN NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain N315) GN=cobB PE=3 SV=1 96 328 4.0E-08
sp|P66815|NPD_STAAM NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cobB PE=1 SV=1 96 328 4.0E-08
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 103 336 5.0E-08
sp|Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio GN=sirt5 PE=1 SV=1 100 325 5.0E-08
sp|Q8NVC8|NPD_STAAW NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MW2) GN=cobB PE=3 SV=1 96 328 6.0E-08
sp|Q6G7B7|NPD_STAAS NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MSSA476) GN=cobB PE=3 SV=1 96 328 6.0E-08
sp|Q8ZU41|NPD1_PYRAE NAD-dependent protein deacetylase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB1 PE=3 SV=1 110 379 6.0E-08
sp|O67919|NPD_AQUAE NAD-dependent protein deacylase OS=Aquifex aeolicus (strain VF5) GN=cobB PE=3 SV=1 109 325 6.0E-08
sp|Q6N6U0|NPD_RHOPA NAD-dependent protein deacetylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cobB PE=3 SV=1 96 266 7.0E-08
sp|Q8U1Q1|NPD_PYRFU NAD-dependent protein deacylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cobB PE=3 SV=2 110 384 7.0E-08
sp|O58669|NPD_PYRHO NAD-dependent protein deacylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cobB PE=3 SV=1 102 325 7.0E-08
sp|Q94AQ6|SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana GN=SRT2 PE=2 SV=1 96 355 8.0E-08
sp|Q6GEN2|NPD_STAAR NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MRSA252) GN=cobB PE=3 SV=1 96 328 8.0E-08
sp|P0CS88|HST22_EMENI NAD-dependent protein deacetylase hst2-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11873 PE=3 SV=1 108 328 1.0E-07
sp|Q3ZBQ0|SIR5_BOVIN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Bos taurus GN=SIRT5 PE=2 SV=1 107 325 2.0E-07
sp|Q8R104|SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus GN=Sirt3 PE=1 SV=2 91 328 2.0E-07
sp|Q8K2C6|SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus GN=Sirt5 PE=1 SV=1 105 325 2.0E-07
sp|E2RDZ6|SIR5_CANLF NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Canis lupus familiaris GN=SIRT5 PE=3 SV=1 107 325 2.0E-07
sp|Q5HE07|NPD_STAAC NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain COL) GN=cobB PE=3 SV=1 96 328 3.0E-07
sp|E1BRE2|SIR5_CHICK NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Gallus gallus GN=SIRT5 PE=3 SV=1 107 325 3.0E-07
sp|Q8A3H9|NPD_BACTN NAD-dependent protein deacylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cobB PE=3 SV=1 107 328 3.0E-07
sp|Q53700|NPD_STAA8 NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain NCTC 8325) GN=cobB PE=3 SV=1 96 328 4.0E-07
sp|B8ARK7|SIR1_ORYSI NAD-dependent protein deacetylase SRT1 OS=Oryza sativa subsp. indica GN=SRT1 PE=2 SV=1 86 244 5.0E-07
sp|Q8IRR5|SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster GN=Sirt4 PE=2 SV=2 96 259 7.0E-07
sp|Q9YB13|NPD_AERPE NAD-dependent protein deacylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cobB PE=3 SV=2 103 381 1.0E-06
sp|Q9RL35|NPD1_STRCO NAD-dependent protein deacetylase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB1 PE=3 SV=1 102 249 1.0E-06
sp|Q97VX5|NPD_SULSO NAD-dependent protein deacetylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cobB PE=1 SV=1 97 328 1.0E-06
sp|Q68F47|SIR5B_XENLA NAD-dependent protein deacylase sirtuin-5B, mitochondrial OS=Xenopus laevis GN=sirt5-b PE=2 SV=1 95 325 1.0E-06
sp|A9SDL4|SIR5_PHYPA NAD-dependent protein deacylase OS=Physcomitrella patens subsp. patens GN=SRT1505 PE=3 SV=1 101 296 4.0E-06
sp|Q9CM50|NPD_PASMU NAD-dependent protein deacylase OS=Pasteurella multocida (strain Pm70) GN=cobB PE=3 SV=1 108 367 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051287 NAD binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5878
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2052
Ophiocordyceps australis map64 (Brazil) OphauB2|3974
Ophiocordyceps camponoti-floridani Ophcf2|00270
Ophiocordyceps camponoti-rufipedis Ophun1|6332 (this protein)
Ophiocordyceps kimflemingae Ophio5|326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6332
MDDALPVFVSTPSSPLSSLPDSPSRPPSPIAIRYPSPESSAALSGTQSPVKVADVLATCPPPAKRRRLVTPRDRS
TAHLDLMKPHDVFGHEDNFHLQRLLSALRSKKKIVVIAGAGISVSAGIPDFRSSTGLFATARSEHKLKASGKHLF
DASVYKHDSSTQSFHTMVRRMAHMTSKAEPTPFHHLVASLAKEGRLLRLYSQNIDCIDTSMAPLHTKVPLEHKGP
WPPTIQLHGGLQKMVCTKCGDLQPFNPDLFDGPEPPPCAECRKTDEVRTAFAGKRSHGIGRLRPRFVLYNEYNPD
EEAIGKVVRADLKARPDAVVVVGTTLKVPGTRRLVKEMCQVARGRKDGFTAWINVDPQPKGSDFKDCWDLVVRSR
CDDVAKLVELPPYDCDIGDDYLVTPDHFRPKSNIQVGISSSPCPDRRDKDDEGPKSAEATRAMPTPRPSPPASQT
RPAVAKRKQTTLPFAKPVDSPSSTKTSKPAVRRSKLPDKAGRGQPRTSLPNFKTVKNVAGNDAKAATRKSMGDTG
VNGPACLSEFTLRPSVTSPKHVRPYTMESSPDTKAVAVSEESAAAEATGLLGTPDGPMQEQDGKPMAVQVGPA*
Coding >Ophun1|6332
ATGGATGACGCTCTACCCGTTTTCGTCTCGACGCCCTCGTCGCCTCTCTCAAGCCTGCCCGACTCGCCGTCGCGG
CCCCCGTCTCCAATCGCCATCCGCTATCCTTCTCCCGAGTCTTCGGCTGCTCTCTCGGGCACCCAGTCGCCCGTC
AAGGTGGCCGATGTCCTCGCCACCTGCCCACCTCCCGCAAAGAGGCGGCGTCTCGTCACGCCTCGCGATCGCTCC
ACGGCTCATCTCGATCTCATGAAGCCGCACGACGTCTTTGGTCACGAGGACAACTTTCATCTTCAGCGCCTGCTC
TCCGCCCTCCGCTCCAAGAAGAAGATTGTCGTCATCGCCGGCGCTGGCATCTCCGTCTCTGCCGGCATTCCCGAC
TTTCGCTCCTCCACCGGCCTCTTCGCCACCGCCCGCTCCGAGCACAAGCTCAAGGCCTCGGGCAAGCACCTCTTC
GACGCCTCCGTCTACAAGCACGACTCCTCCACCCAGTCCTTCCATACCATGGTTCGCCGCATGGCCCACATGACC
AGCAAGGCCGAGCCCACACCCTTCCACCACCTCGTCGCCTCCCTCGCCAAGGAGGGCCGCCTACTGCGCCTCTAC
TCGCAAAACATCGACTGCATCGATACCTCCATGGCGCCCCTCCACACAAAGGTGCCCCTCGAGCACAAAGGCCCC
TGGCCCCCGACCATCCAGCTTCACGGCGGCCTGCAGAAGATGGTCTGCACCAAGTGCGGCGACCTGCAGCCCTTC
AACCCCGACCTCTTTGACGGGCCCGAGCCCCCGCCCTGCGCCGAGTGCCGCAAGACGGACGAGGTCCGCACCGCC
TTCGCAGGGAAGCGCAGTCACGGCATCGGCCGCCTCCGGCCCCGCTTCGTCCTCTACAACGAGTACAACCCGGAC
GAGGAGGCCATCGGCAAGGTGGTGCGCGCCGACCTCAAGGCCCGTCCGGACGCCGTCGTCGTCGTCGGCACCACG
CTCAAGGTGCCCGGCACCCGTCGGCTCGTCAAGGAGATGTGTCAGGTCGCCCGCGGCCGCAAGGACGGGTTCACC
GCCTGGATCAACGTCGACCCTCAGCCCAAGGGCTCTGATTTCAAGGACTGCTGGGACCTGGTGGTCCGGTCCCGC
TGCGATGACGTGGCCAAGCTGGTCGAGCTGCCGCCCTACGACTGCGACATCGGCGACGACTACCTGGTGACGCCC
GATCACTTCCGCCCCAAGAGCAACATCCAAGTCGGCATCAGTTCCTCCCCCTGCCCCGACCGTCGCGACAAGGAC
GACGAGGGGCCCAAGTCGGCCGAGGCCACAAGGGCCATGCCCACGCCACGACCGAGCCCGCCGGCTTCGCAGACG
AGGCCCGCGGTCGCCAAGAGGAAGCAGACGACGCTCCCCTTTGCCAAGCCCGTCGACTCTCCATCGTCCACCAAG
ACGTCCAAGCCAGCCGTCCGCCGATCGAAGCTCCCCGACAAGGCCGGCAGAGGCCAGCCCAGGACCAGTCTGCCC
AACTTCAAGACGGTCAAGAACGTGGCCGGCAACGACGCCAAGGCGGCGACTCGGAAGTCGATGGGCGACACGGGC
GTCAACGGACCAGCCTGCCTGTCCGAGTTTACTCTGCGGCCGTCGGTGACGAGCCCCAAGCATGTGCGTCCATAC
ACGATGGAGAGCTCGCCCGACACCAAGGCCGTTGCCGTTTCGGAGGAGTCGGCGGCTGCGGAGGCGACGGGCCTG
CTCGGGACTCCGGACGGGCCGATGCAGGAGCAGGACGGGAAGCCGATGGCGGTGCAGGTCGGTCCGGCGTGA
Transcript >Ophun1|6332
ATGGATGACGCTCTACCCGTTTTCGTCTCGACGCCCTCGTCGCCTCTCTCAAGCCTGCCCGACTCGCCGTCGCGG
CCCCCGTCTCCAATCGCCATCCGCTATCCTTCTCCCGAGTCTTCGGCTGCTCTCTCGGGCACCCAGTCGCCCGTC
AAGGTGGCCGATGTCCTCGCCACCTGCCCACCTCCCGCAAAGAGGCGGCGTCTCGTCACGCCTCGCGATCGCTCC
ACGGCTCATCTCGATCTCATGAAGCCGCACGACGTCTTTGGTCACGAGGACAACTTTCATCTTCAGCGCCTGCTC
TCCGCCCTCCGCTCCAAGAAGAAGATTGTCGTCATCGCCGGCGCTGGCATCTCCGTCTCTGCCGGCATTCCCGAC
TTTCGCTCCTCCACCGGCCTCTTCGCCACCGCCCGCTCCGAGCACAAGCTCAAGGCCTCGGGCAAGCACCTCTTC
GACGCCTCCGTCTACAAGCACGACTCCTCCACCCAGTCCTTCCATACCATGGTTCGCCGCATGGCCCACATGACC
AGCAAGGCCGAGCCCACACCCTTCCACCACCTCGTCGCCTCCCTCGCCAAGGAGGGCCGCCTACTGCGCCTCTAC
TCGCAAAACATCGACTGCATCGATACCTCCATGGCGCCCCTCCACACAAAGGTGCCCCTCGAGCACAAAGGCCCC
TGGCCCCCGACCATCCAGCTTCACGGCGGCCTGCAGAAGATGGTCTGCACCAAGTGCGGCGACCTGCAGCCCTTC
AACCCCGACCTCTTTGACGGGCCCGAGCCCCCGCCCTGCGCCGAGTGCCGCAAGACGGACGAGGTCCGCACCGCC
TTCGCAGGGAAGCGCAGTCACGGCATCGGCCGCCTCCGGCCCCGCTTCGTCCTCTACAACGAGTACAACCCGGAC
GAGGAGGCCATCGGCAAGGTGGTGCGCGCCGACCTCAAGGCCCGTCCGGACGCCGTCGTCGTCGTCGGCACCACG
CTCAAGGTGCCCGGCACCCGTCGGCTCGTCAAGGAGATGTGTCAGGTCGCCCGCGGCCGCAAGGACGGGTTCACC
GCCTGGATCAACGTCGACCCTCAGCCCAAGGGCTCTGATTTCAAGGACTGCTGGGACCTGGTGGTCCGGTCCCGC
TGCGATGACGTGGCCAAGCTGGTCGAGCTGCCGCCCTACGACTGCGACATCGGCGACGACTACCTGGTGACGCCC
GATCACTTCCGCCCCAAGAGCAACATCCAAGTCGGCATCAGTTCCTCCCCCTGCCCCGACCGTCGCGACAAGGAC
GACGAGGGGCCCAAGTCGGCCGAGGCCACAAGGGCCATGCCCACGCCACGACCGAGCCCGCCGGCTTCGCAGACG
AGGCCCGCGGTCGCCAAGAGGAAGCAGACGACGCTCCCCTTTGCCAAGCCCGTCGACTCTCCATCGTCCACCAAG
ACGTCCAAGCCAGCCGTCCGCCGATCGAAGCTCCCCGACAAGGCCGGCAGAGGCCAGCCCAGGACCAGTCTGCCC
AACTTCAAGACGGTCAAGAACGTGGCCGGCAACGACGCCAAGGCGGCGACTCGGAAGTCGATGGGCGACACGGGC
GTCAACGGACCAGCCTGCCTGTCCGAGTTTACTCTGCGGCCGTCGGTGACGAGCCCCAAGCATGTGCGTCCATAC
ACGATGGAGAGCTCGCCCGACACCAAGGCCGTTGCCGTTTCGGAGGAGTCGGCGGCTGCGGAGGCGACGGGCCTG
CTCGGGACTCCGGACGGGCCGATGCAGGAGCAGGACGGGAAGCCGATGGCGGTGCAGGTCGGTCCGGCGTGA
Gene >Ophun1|6332
ATGGATGACGCTCTACCCGTTTTCGTCTCGACGCCCTCGTCGCCTCTCTCAAGCCTGCCCGACTCGCCGTCGCGG
CCCCCGTCTCCAATCGCCATCCGCTATCCTTCTCCCGAGTCTTCGGCTGCTCTCTCGGGCACCCAGTCGCCCGTC
AAGGTGGCCGATGTCCTCGCCACCTGCCCACCTCCCGCAAAGAGGCGGCGTCTCGTCACGCCTCGCGATCGCTCC
ACGGCTCATCTCGATCTCATGAAGCCGCACGACGTCTTTGGTCACGAGGACAACTTTCATCTTCAGCGCCTGCTC
TCCGCCCTCCGCTCCAAGAAGAAGATTGTCGTCATCGCCGGCGCTGGCATCTCCGTCTCTGCCGGCATTCCCGAC
TTTCGCTCCTCCACCGGCCTCTTCGCCACCGCCCGCTCCGAGCACAAGCTCAAGGCCTCGGGCAAGCACCTCTTC
GACGCCTCCGTCTACAAGCACGACTCCTCCACCCAGTCCTTCCATACCATGGTTCGCCGCATGGCCCACATGACC
AGCAAGGCCGAGCCCACACCCTTCCACCACCTCGTCGCCTCCCTCGCCAAGGAGGGCCGCCTACTGCGCCTCTAC
TCGCAAAACATCGACTGCATCGATACCTCCATGGCGCCCCTCCACACAAAGGTGCCCCTCGAGCACAAAGGCCCC
TGGCCCCCGACCATCCAGCTTCACGGCGGCCTGCAGAAGATGGTCTGCACCAAGTGCGGCGACCTGCAGCCCTTC
AACCCCGACCTCTTTGACGGGCCCGAGCCCCCGCCCTGCGCCGAGTGCCGCAAGACGGACGAGGTCCGCACCGCC
TTCGCAGGGAAGCGCAGTCACGGCATCGGCCGCCTCCGGCCCCGCTTCGTCCTCTACAACGAGTACAACCCGGAC
GAGGAGGCCATCGGCAAGGTGGTGCGCGCCGACCTCAAGGCCCGTCCGGACGCCGTCGTCGTCGTCGGCACCACG
CTCAAGGTGCCCGGCACCCGTCGGCTCGTCAAGGAGATGTGTCAGGTCGCCCGCGGCCGCAAGGACGGGTTCACC
GCCTGGATCAACGTCGACCCTCAGCCCAAGGGCTCTGATTTCAAGGACTGCTGGGACCTGGTGGTCCGGTCCCGC
TGCGATGACGTGGCCAAGCTGGTCGAGCTGCCGCCCTACGACTGCGACATCGGCGACGACTACCTGGTGACGCCC
GATCACTTCCGCCCCAAGAGCAACATCCAAGTCGGCATCAGTTCCTCCCCCTGCCCCGACCGTCGCGACAAGGAC
GACGAGGGGCCCAAGTCGGCCGAGGCCACAAGGGCCATGCCCACGCCACGACCGAGCCCGCCGGCTTCGCAGACG
AGGCCCGCGGTCGCCAAGAGGAAGCAGACGACGCTCCCCTTTGCCAAGCCCGTCGACTCTCCATCGTCCACCAAG
ACGTCCAAGCCAGCCGTCCGCCGATCGAAGCTCCCCGACAAGGCCGGCAGAGGCCAGCCCAGGACCAGTCTGCCC
AACTTCAAGACGGTCAAGAACGTGGCCGGCAACGACGCCAAGGCGGCGACTCGGAAGTCGATGGGCGACACGGGC
GTCAACGGACCAGCCTGCCTGTCCGAGTTTACTCTGCGGCCGTCGGTGACGAGCCCCAAGCATGTGCGTCCATAC
ACGATGGAGAGCTCGCCCGACACCAAGGCCGTTGCCGTTTCGGAGGAGTCGGCGGCTGCGGAGGCGACGGGCCTG
CTCGGGACTCCGGACGGGCCGATGCAGGAGCAGGACGGGAAGCCGATGGCGGTGCAGGTCGGTCCGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail