Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6327
Gene name
LocationContig_683:250..1017
Strand+
Gene length (bp)767
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 34 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1591
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2189
Ophiocordyceps australis map64 (Brazil) OphauB2|2143
Ophiocordyceps camponoti-floridani Ophcf2|00267
Ophiocordyceps camponoti-rufipedis Ophun1|6327 (this protein)
Ophiocordyceps kimflemingae Ophio5|7420
Ophiocordyceps subramaniannii Hirsu2|1217

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6327
MAVFFIGWELWQDMTFVLACCILLVFVIGVVKLWWTNRRLRKYEVIEEERRARLAQMQHCGIDRMHRDAIPFGVR
ALESGVEVEGIWVSRSNTPIVHDVKGKSKFVSSPLNDGQHQPGPPPDPPSTPDETSHIHRSTHPRRLTRPASHAQ
PLPPLGPYDNQFPRDAAPYGTADVYAYDDLDDLPIDVLGVGHELMGPITDADKVNVSPASPPQPRLGQPSKLRRK
PRT*
Coding >Ophun1|6327
ATGGCCGTCTTCTTCATCGGCTGGGAGCTGTGGCAGGACATGACATTTGTGCTCGCCTGCTGCATCCTCCTCGTC
TTCGTCATCGGTGTCGTGAAGCTTTGGTGGACGAACCGGCGATTGCGAAAGTACGAAGTAATCGAGGAGGAGCGT
CGAGCCCGCCTCGCCCAGATGCAGCACTGCGGCATCGATCGTATGCATCGCGACGCTATTCCCTTTGGCGTCCGC
GCTCTCGAGAGCGGTGTCGAGGTCGAGGGTATCTGGGTTTCGCGCTCCAACACGCCCATCGTTCACGATGTCAAG
GGCAAGAGCAAGTTTGTGTCTTCGCCGCTCAACGACGGCCAGCATCAGCCCGGCCCTCCGCCTGACCCGCCGTCG
ACGCCTGACGAGACGAGCCACATCCACCGCTCGACACATCCGCGCCGGTTGACGAGGCCGGCTTCACATGCGCAG
CCGTTGCCCCCCTTGGGACCCTACGATAACCAATTTCCTCGAGATGCTGCGCCCTACGGCACGGCCGACGTCTAC
GCCTACGACGACCTGGATGATCTTCCCATCGATGTCTTGGGCGTGGGACACGAGTTAATGGGTCCCATCACCGAC
GCTGACAAGGTTAATGTGTCGCCTGCGAGCCCGCCACAACCCAGACTTGGGCAGCCGTCCAAGCTCCGCAGGAAG
CCGAGGACATGA
Transcript >Ophun1|6327
ATGGCCGTCTTCTTCATCGGCTGGGAGCTGTGGCAGGACATGACATTTGTGCTCGCCTGCTGCATCCTCCTCGTC
TTCGTCATCGGTGTCGTGAAGCTTTGGTGGACGAACCGGCGATTGCGAAAGTACGAAGTAATCGAGGAGGAGCGT
CGAGCCCGCCTCGCCCAGATGCAGCACTGCGGCATCGATCGTATGCATCGCGACGCTATTCCCTTTGGCGTCCGC
GCTCTCGAGAGCGGTGTCGAGGTCGAGGGTATCTGGGTTTCGCGCTCCAACACGCCCATCGTTCACGATGTCAAG
GGCAAGAGCAAGTTTGTGTCTTCGCCGCTCAACGACGGCCAGCATCAGCCCGGCCCTCCGCCTGACCCGCCGTCG
ACGCCTGACGAGACGAGCCACATCCACCGCTCGACACATCCGCGCCGGTTGACGAGGCCGGCTTCACATGCGCAG
CCGTTGCCCCCCTTGGGACCCTACGATAACCAATTTCCTCGAGATGCTGCGCCCTACGGCACGGCCGACGTCTAC
GCCTACGACGACCTGGATGATCTTCCCATCGATGTCTTGGGCGTGGGACACGAGTTAATGGGTCCCATCACCGAC
GCTGACAAGGTTAATGTGTCGCCTGCGAGCCCGCCACAACCCAGACTTGGGCAGCCGTCCAAGCTCCGCAGGAAG
CCGAGGACATGA
Gene >Ophun1|6327
ATGGCCGTCTTCTTCATCGGCTGGGAGCTGTGGCAGGACATGACATTTGTGAGACGCCTTGCGAGACGCCCTGTC
CTGCCTTCTGCTTCTCTTCTTCTCCTTCTTCCTCTCGAGTCTGACACGACCAGGTGCTCGCCTGCTGCATCCTCC
TCGTCTTCGTCATCGGTGTCGTGAAGCTTTGGTGGACGAACCGGCGATTGCGAAAGTACGAAGTAATCGAGGAGG
AGCGTCGAGCCCGCCTCGCCCAGATGCAGCACTGCGGCATCGATCGTATGCATCGCGACGCTATTCCCTTTGGCG
TCCGCGCTCTCGAGAGCGGTGTCGAGGTCGAGGGTATCTGGGTTTCGCGCTCCAACACGCCCATCGTTCACGATG
TCAAGGGCAAGAGCAAGTTTGTGTCTTCGCCGCTCAACGACGGCCAGCATCAGCCCGGCCCTCCGCCTGACCCGC
CGTCGACGCCTGACGAGACGAGCCACATCCACCGCTCGACACATCCGCGCCGGTTGACGAGGCCGGCTTCACATG
CGCAGCCGTTGCCCCCCTTGGGACCCTACGATAACCAATTTCCTCGAGATGCTGCGCCCTACGGCACGGCCGACG
TCTACGCCTACGACGACCTGGATGATCTTCCCATCGATGTCTTGGGCGTGGGACACGAGTTAATGGGTCCCATCA
CCGACGCTGACAAGGTTAATGTGTCGCCTGCGAGCCCGCCACAACCCAGACTTGGGCAGCCGTCCAAGCTCCGCA
GGAAGCCGAGGACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail