Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6326
Gene name
LocationContig_682:7237..8324
Strand-
Gene length (bp)1087
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07978 NIPSNAP NIPSNAP 1.6E-07 134 208
PF07978 NIPSNAP NIPSNAP 4.9E-32 221 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O55125|NIPS1_MOUSE Protein NipSnap homolog 1 OS=Mus musculus GN=Nipsnap1 PE=1 SV=1 108 319 4.0E-43
sp|Q9PU58|NIPS2_DANRE Protein NipSnap homolog 2 OS=Danio rerio GN=gbas PE=2 SV=2 108 319 4.0E-43
sp|Q9BPW8|NIPS1_HUMAN Protein NipSnap homolog 1 OS=Homo sapiens GN=NIPSNAP1 PE=1 SV=1 108 319 1.0E-42
sp|O55126|NIPS2_MOUSE Protein NipSnap homolog 2 OS=Mus musculus GN=Gbas PE=1 SV=1 108 319 1.0E-41
sp|O75323|NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens GN=GBAS PE=1 SV=1 108 319 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O55125|NIPS1_MOUSE Protein NipSnap homolog 1 OS=Mus musculus GN=Nipsnap1 PE=1 SV=1 108 319 4.0E-43
sp|Q9PU58|NIPS2_DANRE Protein NipSnap homolog 2 OS=Danio rerio GN=gbas PE=2 SV=2 108 319 4.0E-43
sp|Q9BPW8|NIPS1_HUMAN Protein NipSnap homolog 1 OS=Homo sapiens GN=NIPSNAP1 PE=1 SV=1 108 319 1.0E-42
sp|O55126|NIPS2_MOUSE Protein NipSnap homolog 2 OS=Mus musculus GN=Gbas PE=1 SV=1 108 319 1.0E-41
sp|O75323|NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens GN=GBAS PE=1 SV=1 108 319 3.0E-41
sp|Q9VXK0|NIPSN_DROME Protein NipSnap OS=Drosophila melanogaster GN=Nipsnap PE=2 SV=2 95 318 3.0E-40
sp|P34492|YMQ1_CAEEL Putative NipSnap protein K02D10.1 OS=Caenorhabditis elegans GN=K02D10.1 PE=2 SV=4 64 317 3.0E-35
sp|Q54I58|NIPSN_DICDI Protein NipSnap homolog OS=Dictyostelium discoideum GN=nipsnap PE=3 SV=1 102 314 5.0E-16
sp|Q5RAA9|NPS3A_PONAB Protein NipSnap homolog 3A OS=Pongo abelii GN=NIPSNAP3A PE=2 SV=1 212 319 1.0E-08
sp|Q9UFN0|NPS3A_HUMAN Protein NipSnap homolog 3A OS=Homo sapiens GN=NIPSNAP3A PE=1 SV=2 212 319 3.0E-08
sp|Q9BS92|NPS3B_HUMAN Protein NipSnap homolog 3B OS=Homo sapiens GN=NIPSNAP3B PE=2 SV=1 212 317 1.0E-07
sp|Q5RAA9|NPS3A_PONAB Protein NipSnap homolog 3A OS=Pongo abelii GN=NIPSNAP3A PE=2 SV=1 145 319 2.0E-07
sp|Q9UFN0|NPS3A_HUMAN Protein NipSnap homolog 3A OS=Homo sapiens GN=NIPSNAP3A PE=1 SV=2 145 319 2.0E-07
sp|Q9BS92|NPS3B_HUMAN Protein NipSnap homolog 3B OS=Homo sapiens GN=NIPSNAP3B PE=2 SV=1 145 319 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6326
MAAAPRAGVRALSSSAVLRQPKSPSMGDINPSAGSVESFNSKQRAFREQLAEAQREQGARISAQAKQNEPDRKSG
PLSNLIYGTKEGREMEAQIQASFSQVLARGKYVHSIVTHEVKNDRVDEYVDLIGGWYPHIANATENKVHLVGSWR
TEIGDCDTFVHIWEYQKYAGYHESRYSITHHPDFIALDTKLKSMIKAKHVSLMQEFSFWPTTPPRELGGIFELRS
YTLHPGNLLEWETHWRRGLKARREVMEGVGAWFVQIGDLNTVHHLWQFANLEERRERREKSWSVEGWSDTVHKTV
PLIQTMKSRIMIAMPWSPVG*
Coding >Ophun1|6326
ATGGCGGCCGCTCCGCGCGCCGGTGTCAGAGCCCTCAGCTCCTCGGCCGTGCTACGACAGCCCAAATCGCCGTCG
ATGGGCGACATAAACCCGTCGGCCGGGTCGGTCGAGTCCTTCAACAGCAAGCAAAGGGCTTTCCGAGAGCAGCTG
GCCGAAGCCCAGAGGGAGCAGGGAGCACGCATTTCCGCGCAGGCCAAGCAGAACGAGCCCGACCGCAAGTCGGGC
CCTCTGTCTAACCTCATCTACGGCACTAAGGAGGGCCGGGAGATGGAGGCTCAGATCCAGGCCAGCTTCAGTCAG
GTCCTGGCCCGCGGCAAATACGTTCATTCCATCGTCACTCACGAGGTCAAGAACGACAGGGTCGACGAGTATGTC
GATCTTATCGGCGGCTGGTATCCTCACATTGCCAACGCGACCGAGAATAAGGTTCATCTGGTCGGAAGCTGGCGT
ACCGAGATTGGCGATTGCGATACCTTTGTGCATATTTGGGAGTATCAAAAGTACGCCGGCTACCACGAGTCCCGA
TACTCCATCACCCATCACCCCGATTTCATCGCCCTCGACACCAAGCTCAAGTCGATGATCAAGGCCAAGCACGTC
TCCCTCATGCAGGAGTTCTCCTTCTGGCCCACTACGCCGCCCCGTGAGCTGGGGGGCATCTTCGAGCTGAGGTCC
TACACACTGCACCCGGGGAACCTGCTCGAGTGGGAGACGCACTGGCGACGCGGTCTCAAGGCCCGTCGCGAGGTC
ATGGAGGGTGTTGGCGCCTGGTTCGTGCAAATAGGCGACCTCAACACCGTCCACCACCTCTGGCAGTTCGCCAAC
CTCGAGGAGAGGCGCGAGCGCCGCGAGAAGAGCTGGTCCGTCGAGGGATGGAGTGACACAGTTCACAAGACGGTT
CCGCTGATCCAGACGATGAAGTCGAGGATCATGATTGCCATGCCTTGGTCCCCTGTCGGATAG
Transcript >Ophun1|6326
ATGGCGGCCGCTCCGCGCGCCGGTGTCAGAGCCCTCAGCTCCTCGGCCGTGCTACGACAGCCCAAATCGCCGTCG
ATGGGCGACATAAACCCGTCGGCCGGGTCGGTCGAGTCCTTCAACAGCAAGCAAAGGGCTTTCCGAGAGCAGCTG
GCCGAAGCCCAGAGGGAGCAGGGAGCACGCATTTCCGCGCAGGCCAAGCAGAACGAGCCCGACCGCAAGTCGGGC
CCTCTGTCTAACCTCATCTACGGCACTAAGGAGGGCCGGGAGATGGAGGCTCAGATCCAGGCCAGCTTCAGTCAG
GTCCTGGCCCGCGGCAAATACGTTCATTCCATCGTCACTCACGAGGTCAAGAACGACAGGGTCGACGAGTATGTC
GATCTTATCGGCGGCTGGTATCCTCACATTGCCAACGCGACCGAGAATAAGGTTCATCTGGTCGGAAGCTGGCGT
ACCGAGATTGGCGATTGCGATACCTTTGTGCATATTTGGGAGTATCAAAAGTACGCCGGCTACCACGAGTCCCGA
TACTCCATCACCCATCACCCCGATTTCATCGCCCTCGACACCAAGCTCAAGTCGATGATCAAGGCCAAGCACGTC
TCCCTCATGCAGGAGTTCTCCTTCTGGCCCACTACGCCGCCCCGTGAGCTGGGGGGCATCTTCGAGCTGAGGTCC
TACACACTGCACCCGGGGAACCTGCTCGAGTGGGAGACGCACTGGCGACGCGGTCTCAAGGCCCGTCGCGAGGTC
ATGGAGGGTGTTGGCGCCTGGTTCGTGCAAATAGGCGACCTCAACACCGTCCACCACCTCTGGCAGTTCGCCAAC
CTCGAGGAGAGGCGCGAGCGCCGCGAGAAGAGCTGGTCCGTCGAGGGATGGAGTGACACAGTTCACAAGACGGTT
CCGCTGATCCAGACGATGAAGTCGAGGATCATGATTGCCATGCCTTGGTCCCCTGTCGGATAG
Gene >Ophun1|6326
ATGGCGGCCGCTCCGCGCGCCGGTGTCAGAGCCCTCAGCTCCTCGGCCGTGCTACGACAGCCCAAATCGCCGTCG
ATGGGCGACATAAACCCGTCGGCCGGGTCGGTCGAGTCCTTCAACAGCAAGCAAAGGGCTTTCCGAGAGCAGCTG
GCCGAAGCCCAGAGGGAGCAGGGAGCACGTGCGTTGGCCGCCCAGAAGTCCTCCGGTGCTTCGTCGGGTACTGGC
TCATGGCAGAATGCTGCAGGCATTTCCGCGCAGGCCAAGCAGAACGAGCCCGACCGCAAGTCGGGCCCTCTGTCT
AACCTCATCTACGGCACTAAGGAGGGCCGGGAGATGGAGGCTCAGATCCAGGCCAGCTTCAGTCAGGTCCTGGCC
CGCGGCAAATACGTTCATTCCATCGTCACTCACGAGGTCAAGAACGACAGGGTCGACGAGTATGTCGATCTTATC
GGCGGCTGGTATCCTCACATTGCCAACGCGACCGAGAATAAGGTTCATCTGGTCGGAAGCTGGCGTACCGAGATT
GGCGATTGCGATACCTTTGGTTTGTTGTCTTCCTTCTCGACTGTCAGAGAGACTCATGCTAACGACATGTCAACC
AGTGCATATTTGGGAGTATCAAAAGTACGCCGGCTACCACGAGTCCCGATACTCCATCACCCATCACCCCGATTT
CATCGCCCTCGACACCAAGCTCAAGTCGATGATCAAGGCCAAGCACGTCTCCCTCATGCAGGAGTTCTCCTTCTG
GCCCACTACGCCGCCCCGTGAGCTGGGGGGCATCTTCGAGCTGAGGTCCTACACACTGCACCCGGGGAACCTGCT
CGAGTGGGAGACGCACTGGCGACGCGGTCTCAAGGCCCGTCGCGAGGTCATGGAGGGTGTTGGCGCCTGGTTCGT
GCAAATAGGCGACCTCAACACCGTCCACCACCTCTGGCAGTTCGCCAACCTCGAGGAGAGGCGCGAGCGCCGCGA
GAAGAGCTGGTCCGTCGAGGGATGGAGTGACACAGTTCACAAGACGGTTCCGCTGATCCAGACGATGAAGTCGAG
GATCATGATTGCCATGCCTTGGTCCCCTGTCGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail