Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6324
Gene name
LocationContig_682:4799..5387
Strand-
Gene length (bp)588
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12328 Rpp20 Rpp20 subunit of nuclear RNase MRP and P 3.4E-28 44 172
PF01918 Alba Alba 7.4E-11 45 141

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000172 ribonuclease MRP complex Yes
GO:0003676 nucleic acid binding Yes
GO:0006396 RNA processing Yes
GO:0001682 tRNA 5'-leader removal Yes
GO:0005655 nucleolar ribonuclease P complex Yes
GO:0090304 nucleic acid metabolic process No
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0032991 protein-containing complex No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:1902555 endoribonuclease complex No
GO:0009987 cellular process No
GO:1902494 catalytic complex No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0099116 tRNA 5'-end processing No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0046483 heterocycle metabolic process No
GO:0030677 ribonuclease P complex No
GO:0030681 multimeric ribonuclease P complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0034660 ncRNA metabolic process No
GO:0008033 tRNA processing No
GO:0003674 molecular_function No
GO:0000966 RNA 5'-end processing No
GO:0005575 cellular_component No
GO:0034470 ncRNA processing No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6456
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2153
Ophiocordyceps australis map64 (Brazil) OphauB2|837
Ophiocordyceps camponoti-floridani Ophcf2|02658
Ophiocordyceps camponoti-rufipedis Ophun1|6324 (this protein)
Ophiocordyceps kimflemingae Ophio5|2228

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6324
MTKPKPTSPRRRPVEKLPSIPKGSKVRKRPLLRRQVGSSSKNPLIYVSSSTPFMSVVKRVQKQLDKSLRDAAAAA
APRNASLAARVEALKRDGAAAAAAAAAAVSGGVAVTVTSTGKAIEKTLAVAGWFENKGDCVVEVRTGTVGAVDDV
LPAGGEDGDEESRVRRLSCLEVVVRLK*
Coding >Ophun1|6324
ATGACGAAACCGAAGCCGACCTCACCTCGGAGACGACCCGTCGAAAAGCTCCCTTCCATACCAAAAGGGTCCAAA
GTGCGAAAGCGGCCGCTACTTAGACGTCAAGTGGGCTCCTCGTCCAAGAACCCGCTCATCTACGTGTCTTCCTCG
ACGCCCTTCATGTCTGTCGTCAAGCGCGTCCAGAAGCAGCTCGACAAGTCGTTGCGCGACGCCGCCGCTGCTGCC
GCGCCAAGGAACGCCTCTCTTGCTGCGCGCGTGGAGGCCTTGAAGAGGGATGGCGCTGCTGCTGCTGCTGCTGCT
GCTGCTGCTGTCTCTGGTGGTGTGGCGGTGACGGTCACGAGTACGGGCAAGGCTATCGAGAAGACGCTCGCCGTG
GCTGGTTGGTTTGAGAACAAGGGCGACTGCGTGGTGGAGGTCAGGACCGGCACAGTCGGTGCTGTCGATGACGTT
CTCCCCGCCGGGGGGGAGGATGGCGATGAAGAGAGCCGGGTCAGGAGACTCAGCTGCCTCGAGGTGGTAGTGCGT
CTGAAGTAG
Transcript >Ophun1|6324
ATGACGAAACCGAAGCCGACCTCACCTCGGAGACGACCCGTCGAAAAGCTCCCTTCCATACCAAAAGGGTCCAAA
GTGCGAAAGCGGCCGCTACTTAGACGTCAAGTGGGCTCCTCGTCCAAGAACCCGCTCATCTACGTGTCTTCCTCG
ACGCCCTTCATGTCTGTCGTCAAGCGCGTCCAGAAGCAGCTCGACAAGTCGTTGCGCGACGCCGCCGCTGCTGCC
GCGCCAAGGAACGCCTCTCTTGCTGCGCGCGTGGAGGCCTTGAAGAGGGATGGCGCTGCTGCTGCTGCTGCTGCT
GCTGCTGCTGTCTCTGGTGGTGTGGCGGTGACGGTCACGAGTACGGGCAAGGCTATCGAGAAGACGCTCGCCGTG
GCTGGTTGGTTTGAGAACAAGGGCGACTGCGTGGTGGAGGTCAGGACCGGCACAGTCGGTGCTGTCGATGACGTT
CTCCCCGCCGGGGGGGAGGATGGCGATGAAGAGAGCCGGGTCAGGAGACTCAGCTGCCTCGAGGTGGTAGTGCGT
CTGAAGTAG
Gene >Ophun1|6324
ATGACGAAACCGAAGCCGACCTCACCTCGGAGACGACCCGTCGAAAAGCTCCCTTCCATACCAAAAGGTAAGAAA
GAGCCGCAAACTTCGCCCGCAGCGTCCCGGGACTGACACCTTGCAGGGTCCAAAGTGCGAAAGCGGCCGCTACTT
AGACGTCAAGTGGGCTCCTCGTCCAAGAACCCGCTCATCTACGTGTCTTCCTCGACGCCCTTCATGTCTGTCGTC
AAGCGCGTCCAGAAGCAGCTCGACAAGTCGTTGCGCGACGCCGCCGCTGCTGCCGCGCCAAGGAACGCCTCTCTT
GCTGCGCGCGTGGAGGCCTTGAAGAGGGATGGCGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTCTCTGGTGGT
GTGGCGGTGACGGTCACGAGTACGGGCAAGGCTATCGAGAAGACGCTCGCCGTGGCTGGTTGGTTTGAGAACAAG
GGCGACTGCGTGGTGGAGGTCAGGACCGGCACAGTCGGTGCTGTCGATGACGTTCTCCCCGCCGGGGGGGAGGAT
GGCGATGAAGAGAGCCGGGTCAGGAGACTCAGCTGCCTCGAGGTGGTAGTGCGTCTGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail