Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6321
Gene name
LocationContig_681:7183..9542
Strand-
Gene length (bp)2359
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup264
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4823
Ophiocordyceps australis 1348a (Ghana) OphauG2|4824
Ophiocordyceps australis map64 (Brazil) OphauB2|3299
Ophiocordyceps australis map64 (Brazil) OphauB2|3300
Ophiocordyceps camponoti-floridani Ophcf2|06695
Ophiocordyceps camponoti-floridani Ophcf2|06696
Ophiocordyceps camponoti-rufipedis Ophun1|6321 (this protein)
Ophiocordyceps kimflemingae Ophio5|1555
Ophiocordyceps kimflemingae Ophio5|1556
Ophiocordyceps subramaniannii Hirsu2|10758
Ophiocordyceps subramaniannii Hirsu2|10759

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6321
MTAATMGQPRRSQEPPSHGPDKVTTADGSQRPSLSAVEAACGSPRPALLPTDPPPVDHGEEADVDADGAESAGPM
EAAEQMEGHDEPPLKRQKMEPHDAESEALDDEAVLALAAHNGSTGPDPYGSDFDYHGEAKARGDQGLRSNRPVPQ
RACNLNPLVRCTHLACSINERPVGNSNLVDSQQPCYPQQQKAKMPPKQASQWEQPAFLLSLVCALYEVASLTPEA
KKSVEEFLRAEGHNASWDGIRQVMRWTPEVHEDILLAIFQHLTLSAADFESIVADLRERGYSFTESALRQHVQKL
RRNRDAGGKATGTPTKAPAGPKKKAASKKNKKEMSPVDDDDEVKNLKREPEDDDDGELVVKTPVKKRVKKEVKKE
TSSGEDNTDEI*
Coding >Ophun1|6321
ATGACGGCCGCGACCATGGGCCAGCCGCGGCGGAGTCAGGAGCCGCCTTCGCACGGGCCCGACAAGGTGACGACG
GCCGACGGCTCGCAGCGTCCTTCGCTCTCAGCGGTGGAGGCGGCTTGTGGCTCACCCCGACCCGCCTTGCTCCCG
ACCGATCCGCCGCCGGTCGACCATGGCGAAGAGGCCGACGTTGACGCCGACGGGGCCGAGAGTGCCGGTCCCATG
GAGGCGGCCGAACAGATGGAAGGCCACGACGAGCCTCCACTCAAACGGCAGAAGATGGAGCCACACGACGCCGAA
AGCGAGGCCCTCGACGACGAGGCGGTGCTGGCTCTGGCAGCTCATAACGGATCGACGGGTCCCGACCCGTACGGG
TCAGACTTCGACTATCACGGCGAAGCTAAGGCCAGAGGCGACCAGGGTCTGCGCAGCAACAGGCCTGTGCCGCAA
AGAGCCTGCAACTTGAACCCCCTTGTTCGATGCACGCACCTTGCTTGTTCCATCAACGAACGCCCCGTTGGCAAC
TCCAACCTCGTTGACTCGCAGCAACCGTGTTATCCCCAACAGCAGAAGGCAAAGATGCCGCCCAAACAGGCCAGC
CAGTGGGAGCAGCCTGCTTTCCTGCTCAGTCTCGTCTGCGCCCTTTACGAGGTCGCGAGCCTGACGCCCGAGGCG
AAGAAGTCGGTGGAGGAGTTTTTGCGAGCAGAGGGCCACAACGCTTCTTGGGATGGGATCCGGCAGGTGATGAGG
TGGACGCCAGAGGTGCACGAGGACATCCTCCTCGCCATCTTCCAGCACCTGACGCTCTCGGCCGCCGACTTTGAG
AGCATCGTTGCCGATCTGCGGGAGCGGGGATACTCTTTTACTGAGAGTGCTTTGCGCCAGCATGTTCAGAAGTTG
CGTCGCAACCGGGACGCCGGTGGCAAGGCTACAGGCACTCCCACCAAAGCCCCGGCCGGTCCCAAGAAGAAGGCG
GCTTCCAAAAAGAACAAGAAAGAGATGTCGCCTGTCGATGACGACGACGAGGTCAAGAACCTCAAGCGAGAGCCC
GAAGACGACGACGATGGCGAACTCGTCGTCAAAACCCCCGTCAAGAAACGGGTCAAGAAGGAGGTCAAGAAGGAA
ACCTCTTCTGGCGAAGACAATACCGACGAGATTTAG
Transcript >Ophun1|6321
ATGACGGCCGCGACCATGGGCCAGCCGCGGCGGAGTCAGGAGCCGCCTTCGCACGGGCCCGACAAGGTGACGACG
GCCGACGGCTCGCAGCGTCCTTCGCTCTCAGCGGTGGAGGCGGCTTGTGGCTCACCCCGACCCGCCTTGCTCCCG
ACCGATCCGCCGCCGGTCGACCATGGCGAAGAGGCCGACGTTGACGCCGACGGGGCCGAGAGTGCCGGTCCCATG
GAGGCGGCCGAACAGATGGAAGGCCACGACGAGCCTCCACTCAAACGGCAGAAGATGGAGCCACACGACGCCGAA
AGCGAGGCCCTCGACGACGAGGCGGTGCTGGCTCTGGCAGCTCATAACGGATCGACGGGTCCCGACCCGTACGGG
TCAGACTTCGACTATCACGGCGAAGCTAAGGCCAGAGGCGACCAGGGTCTGCGCAGCAACAGGCCTGTGCCGCAA
AGAGCCTGCAACTTGAACCCCCTTGTTCGATGCACGCACCTTGCTTGTTCCATCAACGAACGCCCCGTTGGCAAC
TCCAACCTCGTTGACTCGCAGCAACCGTGTTATCCCCAACAGCAGAAGGCAAAGATGCCGCCCAAACAGGCCAGC
CAGTGGGAGCAGCCTGCTTTCCTGCTCAGTCTCGTCTGCGCCCTTTACGAGGTCGCGAGCCTGACGCCCGAGGCG
AAGAAGTCGGTGGAGGAGTTTTTGCGAGCAGAGGGCCACAACGCTTCTTGGGATGGGATCCGGCAGGTGATGAGG
TGGACGCCAGAGGTGCACGAGGACATCCTCCTCGCCATCTTCCAGCACCTGACGCTCTCGGCCGCCGACTTTGAG
AGCATCGTTGCCGATCTGCGGGAGCGGGGATACTCTTTTACTGAGAGTGCTTTGCGCCAGCATGTTCAGAAGTTG
CGTCGCAACCGGGACGCCGGTGGCAAGGCTACAGGCACTCCCACCAAAGCCCCGGCCGGTCCCAAGAAGAAGGCG
GCTTCCAAAAAGAACAAGAAAGAGATGTCGCCTGTCGATGACGACGACGAGGTCAAGAACCTCAAGCGAGAGCCC
GAAGACGACGACGATGGCGAACTCGTCGTCAAAACCCCCGTCAAGAAACGGGTCAAGAAGGAGGTCAAGAAGGAA
ACCTCTTCTGGCGAAGACAATACCGACGAGATTTAG
Gene >Ophun1|6321
ATGACGGCCGCGACCATGGGCCAGCCGCGGCGGAGTCAGGAGCCGCCTTCGCACGGGCCCGACAAGGTGACGACG
GCCGACGGCTCGCAGCGTCCTTCGCTCTCAGCGGTGGAGGCGGCTTGTGGCTCACCCCGACCCGCCTTGCTCCCG
ACCGATCCGCCGCCGGTCGACCATGGCGAAGAGGCCGACGTTGACGCCGACGGGGCCGAGAGTGCCGGTCCCATG
GAGGCGGCCGAACAGATGGAAGGCCACGACGAGCCTCCACTCAAACGGCAGAAGATGGAGCCACACGACGCCGAA
AGCGAGGCCCTCGACGACGAGGCGGTGCTGGCTCTGGCAGCTCATAACGGATCGACGGGTCCCGACCCGTACGGG
TCAGAGTATGTCTCCCCTTTGCCGCCTTCTGGATTGTGGTGAAGAAGAAGGGTAAGAAGAGGAGAAGAAGATTAA
GGGAGGTGCTAAGAAGTCGACGCCAGCTTCGACTATCACGGCGAAGCGTGAGACCGACCCTGAACATGGGGGGGG
GGGGGGGGGGCGTTTCTTTTTTCCTGTCATGTCGGTTGTCACTAAGGGAGAGAAGGAGAAGAAGATGGGAGGAAG
ATGAGAGGAAGAAGAAGAAAAACGCTTCAGTTCCCGGGAGACAGATGCGCGTCCCGGGCCGACTGACGATGAGCC
GGGTAGAAGGAGGGCTTGAGGAAGGGCGCTCTTTTTTTCTTCACCCGAGCCATGGAGAGAAGATGTAAGACTATT
ATCTACCTACCTACATGTCTAGCCGACCAGCTGTAGAGTGGCTGGAAGCAGTTGACGGCGAGTTACTGTTAGTAA
GGCCAGAGGCGACCAGGGTCTGCGCAGCAACAGGCCTGTGCCGCAAAGAGCCTGCAACTTGAACCCCCTTGTTCG
ATGCACGCACCTTGCTTGTTCCATCAACGAACGCCCCGTTGGCAACTCCAACCTCGTTGACTCGCAGCAACCGTG
TTATCCCCAACAGCAGAAGGCAAAGATGCCGCCCAAACAGGCCAGCCAGTGGGAGCAGCCTGCTTTCCTGCTCAG
TCTCGTCTGCGCCCTTTACGAGGTCGCGAGCCTGACGCCCGAGGCGAAGAAGTCGGTGGAGGAGTTTTTGCGAGC
AGAGGGCCACAACGCTTCTTGGGATGGGATCCGGTACGTCTATTTATTCATTCCCCTTGACGTCTCTTCTCGTTT
TTCTCGCCTTATTTCTTAGAGGAGGGTTTTTCCACCTCTTTAAAATCCTGCTGCCTTCTTCCTCCCGATCCTCAC
CCTCTCTCTTCCAACAACAAACCCTCAACACCGACACCCTTCAAACCCTCACCCCAAACATCCTCACCTCTTCAA
AACCAACCCCCCATCCTTTTGTACTTGGTTCATCTCCGCAGCCATGAGCAGGCAGGTGATGAGGTGGACGCCAGA
GGTGCACGAGGACATCCTCCTCGCCATCTTCCAGCACCTGACGCTCTCGGCCGCCGACTTTGAGAGCATCGTTGC
CGATCTGCGGGAGCGGGGATACTCTTTTACTGAGAGTGCTTTGCGGTGTGTGATTTTTCAGTGTTTTTTGTCGCT
TGCGTTTGTGGTTGGGGCTCGCTGTGGTTCGCTTTTGCCTGCCTGGGCCCGGTTTGCACCCTTTTTTTTTTCTTC
TTCATCTCTTGCAGCTGCTGTTCTTCCTTCTCTCCTCTTTCATCTTCGTTTCCCTGCACGAGCCTCAACGCCAAA
CAGCACTTCATCACTCTTGATCCTTTCCACCTTGTTCGTCGTCGTCGTCATGGCTGGGAAAGCGAGTCGCGGGTG
GGATGCTGCCTCGCACGAGGCTTTGCTTCTGTGCGTTATTGATGAGGTTAAGCCTAGCAAGGCGCTCATCACGCA
GGTTACCGAGAGGATGAAGGCTGCTGGATATACATATTCGTTTGATGCTATCAAGTGATTCCCCCCCCCTTCTTT
ACTTTGCTTACATTCTTTTCTTTCGCATTTGGAGATGAGGTTGATGCTAACGGGTTCGACGTCTACAGCCAGCAT
GTTCAGAAGTTGCGTCGCAACCGGGACGCCGGTGGCAAGGCTACAGGCACTCCCACCAAAGCCCCGGCCGGTCCC
AAGAAGAAGGCGGCTTCCAAAAAGAACAAGAAAGAGATGTCGCCTGTCGATGACGACGACGAGGTCAAGAACCTC
AAGCGAGAGCCCGAAGACGACGACGATGGCGAACTCGTCGTCAAAACCCCCGTCAAGAAACGGGTCAAGAAGGAG
GTCAAGAAGGAAACGTACGTCCATCCCCTCTACCAAACACTCATAGCCAACCATGCTGACCCTCTTGAAATGCAG
CTCTTCTGGCGAAGACAATACCGACGAGATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail