Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6318
Gene name
LocationContig_681:2780..4142
Strand-
Gene length (bp)1362
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02213 GYF GYF domain 1.3E-06 397 440

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94693|LIN1_SCHPO LIN1-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.09c PE=3 SV=1 144 428 6.0E-22
sp|Q9VKV5|CD2B2_DROME CD2 antigen cytoplasmic tail-binding protein 2 homolog OS=Drosophila melanogaster GN=holn1 PE=1 SV=1 204 443 3.0E-08

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6318
MASRYSAARPKRAGENFARTHHHDRNDEGDKKRVKFDVRNPSTLAPDAREDDHVLDADVIGGTSATKRGAVNLDG
YDSDSDNEEFETKAAARRSGQIDLLKQMDNYDAGGDAVENRDDDDDDDMFAADTENTGHDGSKKPQKKQVSFMEY
SQIEGQEDTSKSGGRVRLDEQESSDDEADVELAIQEEGVDEEVGAGGLKRNAPKIEAFNMREEMEQGRFDQNENY
VRNADDPDALHDGWLEGCSKKDMKKAAEAHEKREAEARTKRIQDDGVLVADLLRALISQLERTESALEALARLGK
SQTKSKKLPKWKQKKANKGAECMDVDAEAGEHDAKHAKIKASIDAITEAADKLLSRDFEDIYDQERELLVREYER
RAGEPWVEPEQVADGDEEAEMWEFRWMDGRDGGGAQGPFDGATMKAWDEAGYFGQGGVEFRLAGDDSGRGWMQEA
AFG*
Coding >Ophun1|6318
ATGGCCTCACGATACTCGGCGGCGCGGCCCAAGCGGGCTGGCGAGAACTTTGCGCGGACCCATCACCATGACCGC
AACGACGAGGGAGACAAGAAGAGAGTCAAGTTTGACGTGCGGAATCCATCGACGCTTGCACCGGATGCTCGCGAG
GACGATCATGTGCTCGATGCCGATGTCATTGGTGGCACCAGCGCTACGAAGCGAGGCGCCGTTAATCTCGACGGT
TATGACAGCGATTCGGACAATGAGGAGTTCGAGACCAAAGCTGCAGCCCGTAGGAGCGGCCAAATCGATCTGCTG
AAACAAATGGACAACTACGATGCTGGCGGCGATGCTGTGGAGAATAGAGATGATGACGACGACGATGACATGTTC
GCCGCAGACACGGAGAATACAGGCCACGACGGCTCTAAGAAACCTCAAAAGAAGCAGGTTAGCTTTATGGAGTAC
TCGCAGATCGAAGGCCAAGAGGATACGAGCAAAAGTGGCGGCCGGGTCCGACTAGACGAGCAGGAGAGCAGCGAC
GACGAGGCCGACGTCGAGCTGGCGATACAGGAGGAGGGGGTCGACGAGGAAGTAGGTGCTGGAGGTCTAAAGCGC
AACGCGCCCAAGATTGAAGCATTCAACATGAGGGAAGAGATGGAGCAAGGTCGTTTCGATCAAAACGAAAACTAT
GTTCGCAATGCCGACGACCCGGATGCTTTGCACGACGGTTGGCTCGAGGGGTGCAGCAAGAAAGATATGAAGAAG
GCGGCCGAGGCGCACGAGAAGCGTGAGGCCGAGGCTCGCACCAAGCGCATACAAGACGACGGCGTCTTGGTGGCA
GACCTGCTCCGGGCGCTCATCTCGCAGCTAGAGAGGACAGAGTCTGCGCTCGAGGCTCTGGCCCGGCTAGGCAAG
AGCCAGACCAAGAGCAAAAAGCTGCCCAAGTGGAAGCAGAAGAAGGCGAACAAGGGCGCAGAATGCATGGACGTT
GACGCCGAGGCCGGCGAGCACGACGCCAAGCATGCCAAGATCAAGGCGTCCATCGACGCCATCACCGAGGCGGCC
GACAAGCTCCTCAGCCGGGACTTTGAGGATATTTACGATCAGGAGAGGGAGTTGCTCGTGCGAGAGTACGAGCGG
AGAGCTGGTGAACCGTGGGTCGAGCCCGAGCAGGTGGCCGACGGTGACGAAGAAGCGGAAATGTGGGAATTTCGC
TGGATGGACGGGCGCGATGGCGGCGGCGCGCAGGGTCCCTTTGACGGCGCGACGATGAAGGCCTGGGATGAGGCG
GGCTACTTTGGCCAGGGGGGTGTCGAGTTCCGTCTGGCCGGGGACGACAGCGGCCGGGGCTGGATGCAGGAGGCG
GCCTTCGGGTGA
Transcript >Ophun1|6318
ATGGCCTCACGATACTCGGCGGCGCGGCCCAAGCGGGCTGGCGAGAACTTTGCGCGGACCCATCACCATGACCGC
AACGACGAGGGAGACAAGAAGAGAGTCAAGTTTGACGTGCGGAATCCATCGACGCTTGCACCGGATGCTCGCGAG
GACGATCATGTGCTCGATGCCGATGTCATTGGTGGCACCAGCGCTACGAAGCGAGGCGCCGTTAATCTCGACGGT
TATGACAGCGATTCGGACAATGAGGAGTTCGAGACCAAAGCTGCAGCCCGTAGGAGCGGCCAAATCGATCTGCTG
AAACAAATGGACAACTACGATGCTGGCGGCGATGCTGTGGAGAATAGAGATGATGACGACGACGATGACATGTTC
GCCGCAGACACGGAGAATACAGGCCACGACGGCTCTAAGAAACCTCAAAAGAAGCAGGTTAGCTTTATGGAGTAC
TCGCAGATCGAAGGCCAAGAGGATACGAGCAAAAGTGGCGGCCGGGTCCGACTAGACGAGCAGGAGAGCAGCGAC
GACGAGGCCGACGTCGAGCTGGCGATACAGGAGGAGGGGGTCGACGAGGAAGTAGGTGCTGGAGGTCTAAAGCGC
AACGCGCCCAAGATTGAAGCATTCAACATGAGGGAAGAGATGGAGCAAGGTCGTTTCGATCAAAACGAAAACTAT
GTTCGCAATGCCGACGACCCGGATGCTTTGCACGACGGTTGGCTCGAGGGGTGCAGCAAGAAAGATATGAAGAAG
GCGGCCGAGGCGCACGAGAAGCGTGAGGCCGAGGCTCGCACCAAGCGCATACAAGACGACGGCGTCTTGGTGGCA
GACCTGCTCCGGGCGCTCATCTCGCAGCTAGAGAGGACAGAGTCTGCGCTCGAGGCTCTGGCCCGGCTAGGCAAG
AGCCAGACCAAGAGCAAAAAGCTGCCCAAGTGGAAGCAGAAGAAGGCGAACAAGGGCGCAGAATGCATGGACGTT
GACGCCGAGGCCGGCGAGCACGACGCCAAGCATGCCAAGATCAAGGCGTCCATCGACGCCATCACCGAGGCGGCC
GACAAGCTCCTCAGCCGGGACTTTGAGGATATTTACGATCAGGAGAGGGAGTTGCTCGTGCGAGAGTACGAGCGG
AGAGCTGGTGAACCGTGGGTCGAGCCCGAGCAGGTGGCCGACGGTGACGAAGAAGCGGAAATGTGGGAATTTCGC
TGGATGGACGGGCGCGATGGCGGCGGCGCGCAGGGTCCCTTTGACGGCGCGACGATGAAGGCCTGGGATGAGGCG
GGCTACTTTGGCCAGGGGGGTGTCGAGTTCCGTCTGGCCGGGGACGACAGCGGCCGGGGCTGGATGCAGGAGGCG
GCCTTCGGGTGA
Gene >Ophun1|6318
ATGGCCTCACGATACTCGGCGGCGCGGCCCAAGCGGGCTGGCGAGAACTTTGCGCGGACCCATCACCATGACCGC
AACGACGAGGGAGACAAGAAGAGAGTCAAGTTTGACGTGCGGAATCCATCGACGCTTGCACCGGATGCTCGCGAG
GACGATCATGTGCTCGATGCCGATGTCATTGGTGGCACCAGCGCTACGAAGCGAGGCGCCGTTAATCTCGACGGT
TATGACAGCGATTCGGACAATGAGGAGTTCGAGACCAAAGCTGCAGCCCGTAGGAGCGGCCAAATCGATCTGCTG
AAACAAATGGACAACTACGATGCTGGCGGCGATGCTGTGGAGAATAGAGATGATGACGACGACGATGACATGTTC
GCCGCAGACACGGAGAATACAGGCCACGACGGCTCTAAGAAACCTCAAAAGAAGCAGGTTAGCTTTATGGAGTAC
TCGCAGATCGAAGGCCAAGAGGATACGAGCAAAAGTGGCGGCCGGGTCCGACTAGACGAGCAGGAGAGCAGCGAC
GACGAGGCCGACGTCGAGCTGGCGATACAGGAGGAGGGGGTCGACGAGGAAGTAGGTGCTGGAGGTCTAAAGCGC
AACGCGCCCAAGATTGAAGCATTCAACATGAGGGAAGAGATGGAGCAAGGTCGTTTCGATCAAAACGAAAACTAT
GTTCGCAATGCCGACGACCCGGATGCTTTGCACGACGGTTGGCTCGAGGGGTGCAGCAAGAAAGATATGAAGAAG
GCGGCCGAGGCGCACGAGAAGCGTGAGGCCGAGGCTCGCACCAAGCGCATACAAGACGACGGCGTCTTGGTGGCA
GACCTGCTCCGGGCGCTCATCTCGCAGCTAGAGAGGACAGAGTCTGCGCTCGAGGCTCTGGCCCGGCTAGGCAAG
AGCCAGACCAAGAGCAAAAAGCTGCCCAAGTGGAAGCAGAAGAAGGCGAACAAGGGCGCAGAATGCATGGACGTT
GACGCCGAGGCCGGCGAGCACGACGCCAAGCATGCCAAGATCAAGGCGTCCATCGACGCCATCACCGAGGCGGCC
GACAAGCTCCTCAGCCGGGACTTTGAGGATATTTACGATCAGGAGAGGGAGTTGCTCGTGCGAGAGTACGAGCGG
AGAGCTGGTGAACCGTGGGTCGAGCCCGAGCAGGTGGCCGACGGTGACGAAGAAGCGGAAATGTGGGAATTTCGC
TGGATGGACGGGCGCGATGGCGGCGGCGCGCAGGGTCCCTTTGACGGCGCGACGATGAAGGCCTGGGATGAGGCG
GGCTACTTTGGCCAGGGGGGTGTCGAGTTCCGTCTGGCCGGGGACGACAGCGGCCGGGGCTGGATGCAGGAGGCG
GCCTTCGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail