Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6314
Gene name
LocationContig_680:92..984
Strand+
Gene length (bp)892
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11073|YT45_CAEEL Uncharacterized protein B0416.5 OS=Caenorhabditis elegans GN=B0416.5 PE=4 SV=1 2 221 1.0E-15
sp|Q28FF3|MFS7A_XENTR Major facilitator superfamily domain-containing protein 7-a OS=Xenopus tropicalis GN=mfsd7-A PE=2 SV=1 2 207 4.0E-15
sp|Q503P5|MFSD7_DANRE Major facilitator superfamily domain-containing protein 7 OS=Danio rerio GN=mfsd7 PE=2 SV=1 12 199 5.0E-13
sp|Q9N1F2|FLVC1_FELCA Feline leukemia virus subgroup C receptor-related protein 1 OS=Felis catus GN=FLVCR1 PE=1 SV=1 5 237 1.0E-12
sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens GN=FLVCR1 PE=1 SV=1 31 237 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11073|YT45_CAEEL Uncharacterized protein B0416.5 OS=Caenorhabditis elegans GN=B0416.5 PE=4 SV=1 2 221 1.0E-15
sp|Q28FF3|MFS7A_XENTR Major facilitator superfamily domain-containing protein 7-a OS=Xenopus tropicalis GN=mfsd7-A PE=2 SV=1 2 207 4.0E-15
sp|Q503P5|MFSD7_DANRE Major facilitator superfamily domain-containing protein 7 OS=Danio rerio GN=mfsd7 PE=2 SV=1 12 199 5.0E-13
sp|Q9N1F2|FLVC1_FELCA Feline leukemia virus subgroup C receptor-related protein 1 OS=Felis catus GN=FLVCR1 PE=1 SV=1 5 237 1.0E-12
sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens GN=FLVCR1 PE=1 SV=1 31 237 2.0E-12
sp|Q6P3R2|MFS7B_XENTR Major facilitator superfamily domain-containing protein 7-b OS=Xenopus tropicalis GN=mfsd7-B PE=2 SV=1 2 197 2.0E-12
sp|Q9ES43|FLVC1_MUSTR Feline leukemia virus subgroup C receptor-related protein 1 OS=Mus terricolor GN=Flvcr1 PE=2 SV=1 7 237 8.0E-12
sp|Q6UXD7|MFSD7_HUMAN Major facilitator superfamily domain-containing protein 7 OS=Homo sapiens GN=MFSD7 PE=2 SV=1 1 211 2.0E-11
sp|B2RXV4|FLVC1_MOUSE Feline leukemia virus subgroup C receptor-related protein 1 OS=Mus musculus GN=Flvcr1 PE=2 SV=1 7 237 3.0E-11
sp|Q9UPI3|FLVC2_HUMAN Feline leukemia virus subgroup C receptor-related protein 2 OS=Homo sapiens GN=FLVCR2 PE=1 SV=1 31 219 1.0E-10
sp|Q8CE47|MFSD7_MOUSE Major facilitator superfamily domain-containing protein 7 OS=Mus musculus GN=Mfsd7 PE=2 SV=1 34 211 5.0E-09
sp|P60815|FLVC2_RAT Feline leukemia virus subgroup C receptor-related protein 2 OS=Rattus norvegicus GN=Flvcr2 PE=2 SV=1 3 219 2.0E-08
sp|Q91X85|FLVC2_MOUSE Feline leukemia virus subgroup C receptor-related protein 2 OS=Mus musculus GN=Flvcr2 PE=1 SV=2 31 211 2.0E-08
sp|O01735|YC91_CAEEL Uncharacterized MFS-type transporter C09D4.1 OS=Caenorhabditis elegans GN=C09D4.1 PE=3 SV=2 31 215 2.0E-07
sp|Q6GNV7|DIRC2_XENLA Disrupted in renal carcinoma protein 2 homolog OS=Xenopus laevis GN=dirc2 PE=2 SV=1 30 187 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 60 82 22
3 97 119 22
4 124 146 22
5 156 178 22
6 191 213 22
7 226 248 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6314
MVVKGEEQVSSLVLYVAIISTIASLPAFILPARPPTPISASSTTPKLNLKASMRQLMRSPELFLVMFPFAVVVGF
FNTLSSLLNQIMVPYGFTDDQAGIAGAILIFVGLVTAAISSPLVDRTKAFLPSLRLLLPIIALCFVLFIWMPETR
HLAGPYVVITILGAASFASLPVALEFLAEVSHPLSPEVTSTVAWAAGQLLGAVFIIISGALAGGLDADPPHNLKR
ALIFQGVVAAAVCPLPLFLGRFGRQDKVALRRIDSDRRDGAAVDGPA*
Coding >Ophun1|6314
ATGGTTGTCAAGGGGGAGGAGCAGGTGTCGAGTCTGGTGCTCTATGTGGCCATCATTTCAACCATCGCATCTCTT
CCAGCCTTCATCCTCCCTGCCCGCCCCCCAACCCCCATCTCAGCCTCGAGCACGACGCCCAAGCTCAACCTCAAG
GCCTCGATGCGCCAGCTGATGCGCTCGCCCGAGCTCTTCCTCGTCATGTTCCCCTTTGCCGTCGTCGTCGGCTTC
TTCAACACCTTGTCTTCGCTGCTTAACCAGATCATGGTCCCCTATGGCTTTACAGATGACCAGGCCGGTATTGCT
GGCGCCATCCTCATCTTCGTCGGTCTCGTAACTGCAGCCATCAGCTCGCCACTCGTCGATCGGACAAAGGCCTTT
CTTCCGAGTCTCAGGCTGTTGCTGCCCATCATCGCCCTATGCTTCGTCCTCTTCATATGGATGCCCGAGACGCGT
CATCTGGCTGGACCCTACGTCGTCATCACCATCCTCGGCGCCGCCAGTTTCGCCTCCTTACCCGTTGCCCTCGAG
TTCCTCGCAGAAGTCAGCCACCCCCTGAGTCCCGAAGTCACGTCCACCGTCGCCTGGGCTGCCGGTCAGCTGCTC
GGTGCCGTCTTCATCATCATCAGCGGTGCCCTCGCCGGGGGCCTGGATGCCGATCCTCCGCACAACCTCAAGCGA
GCCCTCATCTTCCAGGGCGTCGTCGCCGCCGCCGTCTGTCCGCTTCCTCTCTTCCTTGGCCGCTTCGGTCGCCAA
GACAAGGTGGCTCTGCGGCGCATAGACTCGGATAGACGGGATGGCGCCGCGGTAGATGGTCCGGCATAG
Transcript >Ophun1|6314
ATGGTTGTCAAGGGGGAGGAGCAGGTGTCGAGTCTGGTGCTCTATGTGGCCATCATTTCAACCATCGCATCTCTT
CCAGCCTTCATCCTCCCTGCCCGCCCCCCAACCCCCATCTCAGCCTCGAGCACGACGCCCAAGCTCAACCTCAAG
GCCTCGATGCGCCAGCTGATGCGCTCGCCCGAGCTCTTCCTCGTCATGTTCCCCTTTGCCGTCGTCGTCGGCTTC
TTCAACACCTTGTCTTCGCTGCTTAACCAGATCATGGTCCCCTATGGCTTTACAGATGACCAGGCCGGTATTGCT
GGCGCCATCCTCATCTTCGTCGGTCTCGTAACTGCAGCCATCAGCTCGCCACTCGTCGATCGGACAAAGGCCTTT
CTTCCGAGTCTCAGGCTGTTGCTGCCCATCATCGCCCTATGCTTCGTCCTCTTCATATGGATGCCCGAGACGCGT
CATCTGGCTGGACCCTACGTCGTCATCACCATCCTCGGCGCCGCCAGTTTCGCCTCCTTACCCGTTGCCCTCGAG
TTCCTCGCAGAAGTCAGCCACCCCCTGAGTCCCGAAGTCACGTCCACCGTCGCCTGGGCTGCCGGTCAGCTGCTC
GGTGCCGTCTTCATCATCATCAGCGGTGCCCTCGCCGGGGGCCTGGATGCCGATCCTCCGCACAACCTCAAGCGA
GCCCTCATCTTCCAGGGCGTCGTCGCCGCCGCCGTCTGTCCGCTTCCTCTCTTCCTTGGCCGCTTCGGTCGCCAA
GACAAGGTGGCTCTGCGGCGCATAGACTCGGATAGACGGGATGGCGCCGCGGTAGATGGTCCGGCATAG
Gene >Ophun1|6314
ATGGTTGTCAAGGGGGAGGAGCAGGTGTCGAGTCTGGTGCTCTATGTGGCCATCATTGTGAGTTGTCAACTCCTG
GACTGGACTGGACTTGAAAGGAGTCAATGGGCTGATGATGCAACCGGGGAAACAGTCAACCATCGCATCTCTTCC
AGCCTTCATCCTCCCTGCCCGCCCCCCAACCCCCATCTCAGCCTCGAGCACGACGCCCAAGCTCAACCTCAAGGC
CTCGATGCGCCAGCTGATGCGCTCGCCCGAGCTCTTCCTCGTCATGTTCCCCTTTGCCGTCGTCGTCGGCTTCTT
CAACACCTTGTCTTCGCTGCTTAACCAGATCATGGTCCCCTATGGCTTTACAGATGACCAGGCCGGTATTGCTGG
CGCCATCCTCATCTTCGTCGGTCTCGTAACTGCAGCCATCAGCTCGCCACTCGTCGATCGGACAAAGGCCTTTCT
TCCGAGTCTCAGGCTGTTGCTGCCCATCATCGCCCTATGCTTCGTCCTCTTCATATGGATGCCCGAGACGCGTCA
TCTGGCTGGACCCTACGTCGTCATCACCATCCTCGGCGCCGCCAGTTTCGCCTCCTTACCCGTTGCCCTCGAGTT
CCTCGCAGAAGTCAGCCACCCCCTGAGTCCCGAAGTCACGTCCACCGTCGCCTGGGCTGCCGGTCAGCTGCTCGG
TGCCGTCTTCATCATCATCAGCGGTGCCCTCGCCGGGGGCCTGGATGCCGATCCTCCGCACAACCTCAAGCGAGC
CCTCATCTTCCAGGGCGTCGTCGCCGCCGCCGTCTGTCCGCTTCCTCTCTTCCTTGGCCGCTTCGGTCGCCAAGA
CAAGGTGGCTCTGCGGCGCATAGACTCGGATAGACGGGATGGCGCCGCGGTAGATGGTCCGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail