Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6309
Gene name
LocationContig_68:36006..36783
Strand+
Gene length (bp)777
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4964
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7076
Ophiocordyceps australis map64 (Brazil) OphauB2|460
Ophiocordyceps camponoti-floridani Ophcf2|02966
Ophiocordyceps camponoti-rufipedis Ophun1|6309 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2023

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6309
MADGTSTMTNNTANMADDKPIPHIHLLLMADGLSEAFDAARLEHNLAPSVSVEVHRGALQFLPSSTRLDLLVSPA
NSYGLMDGGFDDALSRALAPVDDYLALTRIAQARLYQEWRGFAPPGTCTLLRIPDEWEQRSNNAWGARYVAICPT
MRLPQDATWDREVVYECVWSLLCAIDRHNRSGEPRIRSILMTPLATGVGRVSAERWAQQLVLALNHFLDALERPE
LWRALTPSAVDDFASAVAETWDLERRGLRSEYS*
Coding >Ophun1|6309
ATGGCAGACGGAACGAGCACCATGACCAACAACACGGCCAACATGGCAGACGACAAGCCAATCCCCCATATCCAT
CTTCTCCTCATGGCAGACGGCCTAAGCGAGGCCTTTGACGCGGCACGGCTGGAACACAATCTTGCGCCGTCCGTC
TCCGTCGAGGTGCATCGTGGCGCACTGCAGTTCCTCCCGTCTTCGACACGGCTCGATCTGCTCGTTTCGCCGGCC
AACTCGTATGGACTGATGGATGGCGGCTTCGACGATGCTCTCTCCCGCGCGCTGGCACCAGTAGACGACTACCTG
GCCCTGACACGCATCGCTCAGGCGCGCCTCTATCAAGAATGGCGAGGCTTCGCGCCGCCCGGGACCTGCACCTTG
CTGCGCATCCCCGACGAGTGGGAGCAGCGATCCAACAACGCATGGGGCGCGCGATACGTGGCCATCTGCCCGACA
ATGCGGCTTCCACAGGACGCGACCTGGGATCGAGAGGTTGTCTATGAGTGCGTCTGGAGTCTGCTTTGCGCCATC
GACCGCCACAATCGCAGCGGCGAGCCGCGCATCCGCAGCATCCTCATGACGCCGCTGGCAACTGGCGTGGGCCGA
GTGAGTGCCGAGCGATGGGCTCAGCAGCTGGTTCTCGCACTGAACCACTTTCTCGATGCCCTTGAGAGGCCTGAA
CTGTGGAGAGCCTTGACGCCGTCGGCAGTAGATGACTTTGCGAGCGCCGTGGCAGAGACGTGGGACTTGGAGAGA
CGGGGGCTAAGATCTGAGTATTCGTAG
Transcript >Ophun1|6309
ATGGCAGACGGAACGAGCACCATGACCAACAACACGGCCAACATGGCAGACGACAAGCCAATCCCCCATATCCAT
CTTCTCCTCATGGCAGACGGCCTAAGCGAGGCCTTTGACGCGGCACGGCTGGAACACAATCTTGCGCCGTCCGTC
TCCGTCGAGGTGCATCGTGGCGCACTGCAGTTCCTCCCGTCTTCGACACGGCTCGATCTGCTCGTTTCGCCGGCC
AACTCGTATGGACTGATGGATGGCGGCTTCGACGATGCTCTCTCCCGCGCGCTGGCACCAGTAGACGACTACCTG
GCCCTGACACGCATCGCTCAGGCGCGCCTCTATCAAGAATGGCGAGGCTTCGCGCCGCCCGGGACCTGCACCTTG
CTGCGCATCCCCGACGAGTGGGAGCAGCGATCCAACAACGCATGGGGCGCGCGATACGTGGCCATCTGCCCGACA
ATGCGGCTTCCACAGGACGCGACCTGGGATCGAGAGGTTGTCTATGAGTGCGTCTGGAGTCTGCTTTGCGCCATC
GACCGCCACAATCGCAGCGGCGAGCCGCGCATCCGCAGCATCCTCATGACGCCGCTGGCAACTGGCGTGGGCCGA
GTGAGTGCCGAGCGATGGGCTCAGCAGCTGGTTCTCGCACTGAACCACTTTCTCGATGCCCTTGAGAGGCCTGAA
CTGTGGAGAGCCTTGACGCCGTCGGCAGTAGATGACTTTGCGAGCGCCGTGGCAGAGACGTGGGACTTGGAGAGA
CGGGGGCTAAGATCTGAGTATTCGTAG
Gene >Ophun1|6309
ATGGCAGACGGAACGAGCACCATGACCAACAACACGGCCAACATGGCAGACGACAAGCCAATCCCCCATATCCAT
CTTCTCCTCATGGCAGACGGCCTAAGCGAGGCCTTTGACGCGGCACGGCTGGAACACAATCTTGCGCCGTCCGTC
TCCGTCGAGGTGCATCGTGGCGCACTGCAGTTCCTCCCGTCTTCGACACGGCTCGATCTGCTCGTTTCGCCGGCC
AACTCGTATGGACTGATGGATGGCGGCTTCGACGATGCTCTCTCCCGCGCGCTGGCACCAGTAGACGACTACCTG
GCCCTGACACGCATCGCTCAGGCGCGCCTCTATCAAGAATGGCGAGGCTTCGCGCCGCCCGGGACCTGCACCTTG
CTGCGCATCCCCGACGAGTGGGAGCAGCGATCCAACAACGCATGGGGCGCGCGATACGTGGCCATCTGCCCGACA
ATGCGGCTTCCACAGGACGCGACCTGGGATCGAGAGGTTGTCTATGAGTGCGTCTGGAGTCTGCTTTGCGCCATC
GACCGCCACAATCGCAGCGGCGAGCCGCGCATCCGCAGCATCCTCATGACGCCGCTGGCAACTGGCGTGGGCCGA
GTGAGTGCCGAGCGATGGGCTCAGCAGCTGGTTCTCGCACTGAACCACTTTCTCGATGCCCTTGAGAGGCCTGAA
CTGTGGAGAGCCTTGACGCCGTCGGCAGTAGATGACTTTGCGAGCGCCGTGGCAGAGACGTGGGACTTGGAGAGA
CGGGGGCTAAGATCTGAGTATTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail