Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6301
Gene name
LocationContig_68:17361..18675
Strand+
Gene length (bp)1314
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08498 Sterol_MT_C Sterol methyltransferase C-terminal 2.6E-30 314 378
PF08241 Methyltransf_11 Methyltransferase domain 9.4E-21 134 230
PF13649 Methyltransf_25 Methyltransferase domain 1.3E-19 133 228
PF13847 Methyltransf_31 Methyltransferase domain 6.4E-17 129 234
PF08242 Methyltransf_12 Methyltransferase domain 8.9E-12 134 230
PF13489 Methyltransf_23 Methyltransferase domain 5.6E-12 128 282
PF02353 CMAS Mycolic acid cyclopropane synthetase 1.8E-11 79 257
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.8E-10 120 234
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 6.7E-05 127 231
PF07021 MetW Methionine biosynthesis protein MetW 1.8E-04 127 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 3 380 0.0E+00
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 2 379 5.0E-165
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 2 379 5.0E-165
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 4 378 1.0E-160
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 3 378 1.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 3 380 0.0E+00
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 2 379 5.0E-165
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 2 379 5.0E-165
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 4 378 1.0E-160
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 3 378 1.0E-156
sp|Q875K1|ERG6_CLAL4 Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 8 379 7.0E-153
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 7 379 2.0E-151
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 4 380 8.0E-151
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 16 378 5.0E-146
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 6 378 1.0E-145
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 9 378 6.0E-142
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 15 380 1.0E-141
sp|P25087|ERG6_YEAST Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 9 378 2.0E-140
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 72 378 1.0E-108
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 43 379 8.0E-104
sp|Q54I98|SMT1_DICDI Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 71 378 4.0E-93
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 28 378 2.0E-73
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 27 380 4.0E-72
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 28 378 8.0E-72
sp|H2E7T9|SMTL2_BOTBR Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 75 378 1.0E-63
sp|H2E7T7|BOMT_BOTBR Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 32 378 3.0E-62
sp|H2E7T5|SQMT1_BOTBR Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 79 378 6.0E-61
sp|H2E7T6|SQMT2_BOTBR Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 49 378 7.0E-57
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 79 378 5.0E-56
sp|H2E7U0|SMTL3_BOTBR Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 79 378 1.0E-51
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 58 363 5.0E-33
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 84 299 3.0E-22
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 90 240 2.0E-21
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 80 293 3.0E-21
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 81 228 5.0E-14
sp|Q9RMN9|MTF2_MYCS2 Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 114 230 1.0E-13
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 83 299 1.0E-13
sp|Q83WC3|SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 96 245 8.0E-13
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 121 228 2.0E-11
sp|Q9KJ21|SDMT_HALHR Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 70 230 4.0E-11
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 125 290 6.0E-11
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 134 235 2.0E-10
sp|Q8FUZ3|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 134 235 2.0E-10
sp|Q7U4Z9|SDMT_SYNPX Dimethylglycine N-methyltransferase OS=Synechococcus sp. (strain WH8102) GN=bsmB PE=1 SV=1 87 230 2.0E-10
sp|P64842|Y1440_MYCBO Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 121 235 3.0E-10
sp|P9WLY7|Y1405_MYCTU Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 121 235 3.0E-10
sp|P9WLY6|Y1405_MYCTO Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 121 235 3.0E-10
sp|Q8YDE4|UBIE_BRUME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiE PE=3 SV=1 134 235 4.0E-10
sp|C0RMK3|UBIE_BRUMB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiE PE=3 SV=1 134 235 4.0E-10
sp|Q576Q0|UBIE_BRUAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus biovar 1 (strain 9-941) GN=ubiE PE=3 SV=1 134 235 4.0E-10
sp|Q2YJM4|UBIE_BRUA2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain 2308) GN=ubiE PE=3 SV=1 134 235 4.0E-10
sp|B2SC50|UBIE_BRUA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain S19) GN=ubiE PE=3 SV=1 134 235 4.0E-10
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 125 228 5.0E-10
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 125 228 5.0E-10
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 125 228 5.0E-10
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 119 232 6.0E-10
sp|P67064|MENG_TROWT Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 125 235 1.0E-09
sp|P67065|MENG_TROW8 Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 125 235 1.0E-09
sp|A0PQ29|PHMT2_MYCUA Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2009 PE=3 SV=1 130 230 3.0E-09
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 125 229 3.0E-09
sp|A6WYI0|UBIE_OCHA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 134 247 3.0E-09
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 42 235 5.0E-09
sp|A0PQX0|PHMT1_MYCUA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 130 228 5.0E-09
sp|A9WW74|UBIE_BRUSI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiE PE=3 SV=1 134 235 5.0E-09
sp|B1J2S8|UBIE_PSEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain W619) GN=ubiE PE=3 SV=1 126 242 6.0E-09
sp|P9WIN3|PHMT_MYCTU Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2952 PE=1 SV=1 130 230 7.0E-09
sp|P9WIN2|PHMT_MYCTO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3026 PE=3 SV=1 130 230 7.0E-09
sp|A5U6W0|PHMT_MYCTA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2979 PE=3 SV=1 130 230 7.0E-09
sp|A1KMU6|PHMT_MYCBP Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2973 PE=3 SV=1 130 230 7.0E-09
sp|Q7TXK3|PHMT_MYCBO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2976 PE=3 SV=1 130 230 7.0E-09
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 68 214 8.0E-09
sp|B0KM36|UBIE_PSEPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain GB-1) GN=ubiE PE=3 SV=1 126 242 9.0E-09
sp|Q88D17|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 126 242 9.0E-09
sp|A5WA45|UBIE_PSEP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 126 242 9.0E-09
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 126 242 9.0E-09
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 126 242 9.0E-09
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 126 242 9.0E-09
sp|B3Q619|UBIE_RHOPT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain TIE-1) GN=ubiE PE=3 SV=1 132 239 2.0E-08
sp|Q6NDM2|UBIE_RHOPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ubiE PE=3 SV=1 132 239 2.0E-08
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 68 214 2.0E-08
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 125 229 2.0E-08
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 130 234 2.0E-08
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 126 235 2.0E-08
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 120 234 2.0E-08
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 120 234 2.0E-08
sp|C3K8U4|UBIE_PSEFS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain SBW25) GN=ubiE PE=3 SV=1 126 243 2.0E-08
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 121 228 2.0E-08
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 117 234 2.0E-08
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 121 234 2.0E-08
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 121 234 2.0E-08
sp|Q87UZ2|UBIE_PSESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 126 242 3.0E-08
sp|Q4ZZG3|UBIE_PSEU2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 126 242 3.0E-08
sp|Q48PJ4|UBIE_PSE14 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 126 242 3.0E-08
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 130 288 4.0E-08
sp|A5E888|UBIE_BRASB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ubiE PE=3 SV=1 133 247 4.0E-08
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 121 234 4.0E-08
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 68 214 4.0E-08
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 121 234 4.0E-08
sp|Q3KJC5|UBIE_PSEPF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiE PE=3 SV=1 126 242 4.0E-08
sp|Q5N4X9|MENG_SYNP6 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=menG PE=3 SV=1 128 228 5.0E-08
sp|Q31P90|MENG_SYNE7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=menG PE=3 SV=1 128 228 5.0E-08
sp|Q57060|Y095_HAEIN Uncharacterized protein HI_0095 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0095 PE=4 SV=1 120 238 5.0E-08
sp|Q92SK7|UBIE_RHIME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium meliloti (strain 1021) GN=ubiE PE=3 SV=2 128 235 5.0E-08
sp|Q13EN8|UBIE_RHOPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain BisB5) GN=ubiE PE=3 SV=1 132 239 6.0E-08
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 120 234 6.0E-08
sp|C1DHS2|UBIE_AZOVD Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiE PE=3 SV=1 126 235 6.0E-08
sp|C3MCY6|UBIE_RHISN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium sp. (strain NGR234) GN=ubiE PE=3 SV=1 128 235 7.0E-08
sp|Q9CD86|PHMT_MYCLE Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium leprae (strain TN) GN=ML0130 PE=3 SV=1 130 228 7.0E-08
sp|Q4L6H3|MENG_STAHJ Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 120 234 7.0E-08
sp|B5ZYK8|UBIE_RHILW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ubiE PE=3 SV=1 128 239 1.0E-07
sp|A4YJH0|UBIE_BRASO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain ORS278) GN=ubiE PE=3 SV=1 133 247 1.0E-07
sp|Q0WPT7|Y2104_ARATH Uncharacterized methyltransferase At2g41040, chloroplastic OS=Arabidopsis thaliana GN=At2g41040 PE=2 SV=1 86 230 1.0E-07
sp|B0KTX4|UBIG_PSEPG Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=ubiG PE=3 SV=1 130 228 1.0E-07
sp|Q88M10|UBIG_PSEPK Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiG PE=3 SV=1 130 228 1.0E-07
sp|A5W7G3|UBIG_PSEP1 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiG PE=3 SV=1 130 228 1.0E-07
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 125 228 2.0E-07
sp|A1UUE1|UBIE_BARBK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ubiE PE=3 SV=1 129 235 2.0E-07
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 113 240 2.0E-07
sp|B1J5G4|UBIG_PSEPW Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain W619) GN=ubiG PE=3 SV=1 130 228 2.0E-07
sp|Q98GV1|UBIE_RHILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 128 235 2.0E-07
sp|B9J7S8|UBIE_AGRRK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ubiE PE=3 SV=1 132 239 2.0E-07
sp|Q16DL1|UBIE_ROSDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiE PE=3 SV=1 130 235 2.0E-07
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 125 228 2.0E-07
sp|B9JZF4|UBIE_AGRVS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ubiE PE=3 SV=1 130 235 3.0E-07
sp|Q8UIH5|UBIE_AGRFC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ubiE PE=3 SV=1 132 239 3.0E-07
sp|Q1MME0|UBIE_RHIL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ubiE PE=3 SV=1 128 239 3.0E-07
sp|Q885T9|UBIG_PSESM Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiG PE=3 SV=2 130 228 3.0E-07
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 117 234 3.0E-07
sp|Q9CMI6|UBIG_PASMU Ubiquinone biosynthesis O-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiG PE=3 SV=1 108 230 3.0E-07
sp|A9ILA7|UBIE_BART1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ubiE PE=3 SV=1 132 235 3.0E-07
sp|A4VGE5|UBIE_PSEU5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas stutzeri (strain A1501) GN=ubiE PE=3 SV=1 42 235 4.0E-07
sp|B8EI29|UBIG_METSB Ubiquinone biosynthesis O-methyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ubiG PE=3 SV=1 129 230 4.0E-07
sp|B9KQJ8|UBIE_RHOSK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiE PE=3 SV=1 130 288 4.0E-07
sp|Q3IY65|UBIE_RHOS4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiE PE=3 SV=1 130 288 4.0E-07
sp|A3PFL1|UBIE_RHOS1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiE PE=3 SV=1 130 288 4.0E-07
sp|Q2KDB0|UBIE_RHIEC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ubiE PE=3 SV=1 128 239 6.0E-07
sp|Q4K8M4|UBIG_PSEF5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 103 228 6.0E-07
sp|Q1IDA6|UBIG_PSEE4 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 130 228 6.0E-07
sp|A4WVR7|UBIE_RHOS5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiE PE=3 SV=1 130 235 7.0E-07
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 125 228 8.0E-07
sp|B8IJ00|UBIE_METNO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ubiE PE=3 SV=1 132 247 8.0E-07
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 130 229 9.0E-07
sp|A6UFF7|UBIE_SINMW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Sinorhizobium medicae (strain WSM419) GN=ubiE PE=3 SV=1 128 235 1.0E-06
sp|B2VG41|UBIE_ERWT9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiE PE=3 SV=1 126 235 1.0E-06
sp|Q2J2H9|UBIE_RHOP2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain HaA2) GN=ubiE PE=3 SV=1 132 239 1.0E-06
sp|Q6G577|UBIE_BARHE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiE PE=3 SV=1 132 235 1.0E-06
sp|Q3K8T6|UBIG_PSEPF Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 130 228 1.0E-06
sp|A1TSA0|UBIG_ACIAC Ubiquinone biosynthesis O-methyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ubiG PE=3 SV=1 129 303 1.0E-06
sp|A1SRS4|UBIE_PSYIN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Psychromonas ingrahamii (strain 37) GN=ubiE PE=3 SV=1 126 235 1.0E-06
sp|Q55423|Y829_SYNY3 Uncharacterized methyltransferase sll0829 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0829 PE=3 SV=1 124 234 2.0E-06
sp|C3K6J1|UBIG_PSEFS Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 130 228 2.0E-06
sp|Q7NZ91|UBIG_CHRVO Ubiquinone biosynthesis O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiG PE=3 SV=1 130 228 2.0E-06
sp|A8H966|UBIE_SHEPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 118 235 2.0E-06
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 130 230 3.0E-06
sp|B3PZ92|UBIE_RHIE6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium etli (strain CIAT 652) GN=ubiE PE=3 SV=1 128 239 3.0E-06
sp|B7VGS0|UBIG_VIBTL Ubiquinone biosynthesis O-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=ubiG PE=3 SV=1 108 228 3.0E-06
sp|Q2SN12|UBIE_HAHCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 126 235 3.0E-06
sp|B0TJ16|UBIE_SHEHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 118 235 3.0E-06
sp|Q02PX7|UBIG_PSEAB Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiG PE=3 SV=1 130 228 4.0E-06
sp|Q47GP8|UBIG_DECAR Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 130 228 4.0E-06
sp|Q820B5|UBIG_COXBU Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 129 228 5.0E-06
sp|A9NBI0|UBIG_COXBR Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 129 228 5.0E-06
sp|B6J1W2|UBIG_COXB2 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 129 228 5.0E-06
sp|A9L2Y4|UBIG_SHEB9 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS195) GN=ubiG PE=3 SV=1 119 228 5.0E-06
sp|A6WNN7|UBIG_SHEB8 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS185) GN=ubiG PE=3 SV=1 119 228 5.0E-06
sp|A3D499|UBIG_SHEB5 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiG PE=3 SV=1 119 228 5.0E-06
sp|B8EA88|UBIG_SHEB2 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS223) GN=ubiG PE=3 SV=1 119 228 5.0E-06
sp|B6J5Y2|UBIG_COXB1 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 129 228 5.0E-06
sp|A9KGL7|UBIG_COXBN Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 129 228 5.0E-06
sp|Q9HZ63|UBIG_PSEAE Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiG PE=3 SV=1 130 228 5.0E-06
sp|B7V9J5|UBIG_PSEA8 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiG PE=3 SV=1 130 228 6.0E-06
sp|B5XNZ3|UBIG_KLEP3 Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=ubiG PE=3 SV=1 120 228 7.0E-06
sp|A6TBT7|UBIG_KLEP7 Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiG PE=3 SV=1 120 228 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003824 catalytic activity No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0006629 lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0008202 steroid metabolic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6301
MPPSKSDLEREDHGRDAAFNKAMHGNSAQARGGIAAMFSKGADAKKAAVDEYFKHWDNKPAADETPEQRAARTAE
YATLTRHYYNLATDLYEYGWGQSFHFCRFSKGEPFYQAIARHEHYLAHSMGIQEGSRVLDVGCGVGGPAREIAKF
TGAHITGLNNNDYQIERATHYAAQEGLSDQLNFVKGDFMQMSFPDNSFDAVYAIEATVHAPTLEGIYSQIYRVLK
PGGVFGVYEWLMTDEYDNDNLHHREIRLGIEQGDGISNMCKVSEALDAIKAAGFELVRNEDLADRPDPLPWYWPL
SGDMRYIQSIGDIFTIARMTRWGRAMAHNLAGLLETIRLAPAGTKKTADSLAVAADCLVAGGRERLFTPMYLMVA
RKPIQ*
Coding >Ophun1|6301
ATGCCGCCCTCCAAGTCGGATCTCGAGCGCGAAGATCATGGCCGCGATGCCGCGTTCAACAAGGCCATGCATGGC
AATTCGGCCCAGGCTCGTGGCGGCATAGCGGCCATGTTCTCCAAGGGCGCCGATGCGAAGAAGGCGGCTGTCGAC
GAGTATTTCAAGCACTGGGACAACAAGCCTGCTGCCGACGAGACGCCTGAGCAGCGCGCTGCGAGAACGGCCGAA
TATGCGACCCTGACGAGGCACTACTACAACCTCGCGACGGACCTGTACGAGTATGGCTGGGGCCAGTCGTTCCAC
TTCTGCCGCTTCTCCAAGGGCGAACCCTTTTACCAGGCCATTGCCCGCCACGAACACTACCTGGCTCACAGCATG
GGCATTCAGGAGGGCAGCCGCGTGCTCGACGTCGGGTGTGGCGTCGGTGGGCCGGCCCGCGAGATCGCCAAGTTC
ACGGGCGCCCACATCACGGGCCTGAACAACAACGACTACCAGATCGAACGCGCCACCCACTATGCCGCCCAGGAG
GGGCTGTCTGACCAGCTCAACTTTGTCAAGGGCGACTTTATGCAAATGTCGTTCCCGGACAACAGTTTCGATGCC
GTCTACGCCATCGAGGCGACGGTGCACGCGCCGACGCTTGAAGGCATCTACAGCCAGATCTACCGCGTCCTGAAG
CCTGGCGGAGTCTTTGGCGTTTACGAGTGGCTCATGACGGACGAGTACGATAACGACAACCTCCATCACCGCGAG
ATTCGGCTCGGCATCGAACAGGGAGACGGAATTTCCAACATGTGCAAGGTCTCGGAGGCTCTAGACGCTATCAAG
GCCGCTGGCTTCGAGCTCGTGCGCAACGAGGATCTCGCCGACCGTCCGGACCCCCTGCCCTGGTACTGGCCCCTA
TCGGGAGACATGCGCTACATACAATCCATTGGCGACATCTTTACCATTGCTCGCATGACTCGATGGGGCCGCGCC
ATGGCTCACAACTTGGCTGGCCTGCTCGAGACGATTAGACTGGCTCCGGCGGGAACGAAGAAGACGGCTGATAGC
TTGGCGGTTGCTGCCGACTGCCTCGTTGCTGGCGGACGTGAGCGTCTGTTTACGCCCATGTATCTGATGGTCGCT
CGCAAGCCGATTCAATGA
Transcript >Ophun1|6301
ATGCCGCCCTCCAAGTCGGATCTCGAGCGCGAAGATCATGGCCGCGATGCCGCGTTCAACAAGGCCATGCATGGC
AATTCGGCCCAGGCTCGTGGCGGCATAGCGGCCATGTTCTCCAAGGGCGCCGATGCGAAGAAGGCGGCTGTCGAC
GAGTATTTCAAGCACTGGGACAACAAGCCTGCTGCCGACGAGACGCCTGAGCAGCGCGCTGCGAGAACGGCCGAA
TATGCGACCCTGACGAGGCACTACTACAACCTCGCGACGGACCTGTACGAGTATGGCTGGGGCCAGTCGTTCCAC
TTCTGCCGCTTCTCCAAGGGCGAACCCTTTTACCAGGCCATTGCCCGCCACGAACACTACCTGGCTCACAGCATG
GGCATTCAGGAGGGCAGCCGCGTGCTCGACGTCGGGTGTGGCGTCGGTGGGCCGGCCCGCGAGATCGCCAAGTTC
ACGGGCGCCCACATCACGGGCCTGAACAACAACGACTACCAGATCGAACGCGCCACCCACTATGCCGCCCAGGAG
GGGCTGTCTGACCAGCTCAACTTTGTCAAGGGCGACTTTATGCAAATGTCGTTCCCGGACAACAGTTTCGATGCC
GTCTACGCCATCGAGGCGACGGTGCACGCGCCGACGCTTGAAGGCATCTACAGCCAGATCTACCGCGTCCTGAAG
CCTGGCGGAGTCTTTGGCGTTTACGAGTGGCTCATGACGGACGAGTACGATAACGACAACCTCCATCACCGCGAG
ATTCGGCTCGGCATCGAACAGGGAGACGGAATTTCCAACATGTGCAAGGTCTCGGAGGCTCTAGACGCTATCAAG
GCCGCTGGCTTCGAGCTCGTGCGCAACGAGGATCTCGCCGACCGTCCGGACCCCCTGCCCTGGTACTGGCCCCTA
TCGGGAGACATGCGCTACATACAATCCATTGGCGACATCTTTACCATTGCTCGCATGACTCGATGGGGCCGCGCC
ATGGCTCACAACTTGGCTGGCCTGCTCGAGACGATTAGACTGGCTCCGGCGGGAACGAAGAAGACGGCTGATAGC
TTGGCGGTTGCTGCCGACTGCCTCGTTGCTGGCGGACGTGAGCGTCTGTTTACGCCCATGTATCTGATGGTCGCT
CGCAAGCCGATTCAATGA
Gene >Ophun1|6301
ATGCCGCCCTCCAAGTCGGATCTCGAGCGCGAAGATCATGGCCGCGATGCCGCGTTCAACAAGGCCATGCATGGC
AATTCGGCCCAGGCTCGTGGCGGCATAGCGGCCATGTTCTCCAAGGGCGCCGATGCGAAGAAGGCGGCTGTCGAC
GAGTATTTCAAGCACTGGGACAACAAGCCTGCTGCCGACGAGACGCCTGAGCAGCGCGCTGTGAGTCTGGGTTAA
ATGTGACGATGTGATATCGAGCGACTGACTGCGTGCTAGGCGAGAACGGCCGAATATGCGACCCTGACGAGGCAG
TGAGTACATGCTCGACAGCTCCCATCTCTCGGAAACATCCATCTGACACCCTTATCAGCTACTACAACCTCGCGA
CGGACCTGTACGAGTATGGCTGGGGCCAGTCGTTCCACTTCTGCCGCTTCTCCAAGGGCGAACCCTTTTACCAGG
CCATTGCCCGCCACGAACACTACCTGGCTCACAGCATGGGCATTCAGGAGGGCAGCCGCGTGCTCGACGTCGGGT
GTGGCGTCGGTGGGCCGGCCCGCGAGATCGCCAAGTTCACGGGCGCCCACATCACGGGCCTGAACAACAACGACT
ACCAGATCGAACGCGCCACCCACTATGCCGCCCAGGAGGGGCTGTCTGACCAGCTCAACTTTGTCAAGGGCGACT
TTATGGTGAGCAGGGAGAAGGCTGGCTCGGACGACACGGGCCGCGACGCTGACGGGGGAATAGCAAATGTCGTTC
CCGGACAACAGTTTCGATGCCGTCTACGCCATCGAGGCGACGGTGCACGCGCCGACGCTTGAAGGCATCTACAGC
CAGATCTACCGCGTCCTGAAGCCTGGCGGAGTCTTTGGCGTTTACGAGTGGCTCATGACGGACGAGTACGATAAC
GACAACCTCCATCACCGCGAGATTCGGCTCGGCATCGAACAGGGAGACGGAATTTCCAACATGTGCAAGGTCTCG
GAGGCTCTAGACGCTATCAAGGCCGCTGGCTTCGAGCTCGTGCGCAACGAGGATCTCGCCGACCGTCCGGACCCC
CTGCCCTGGTACTGGCCCCTATCGGGAGACATGCGCTACATACAATCCATTGGCGACATCTTTACCATTGCTCGC
ATGACTCGATGGGGCCGCGCCATGGCTCACAACTTGGCTGGCCTGCTCGAGACGATTAGACTGGCTCCGGCGGGA
ACGAAGAAGACGGCTGATAGCTTGGCGGTTGCTGCCGACTGCCTCGTTGCTGGCGGACGTGAGCGTCTGTTTACG
CCCATGTATCTGATGGTCGCTCGCAAGCCGATTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail