Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6295
Gene name
LocationContig_68:5019..5608
Strand+
Gene length (bp)589
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 3.5E-06 23 49

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UKJ3|GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens GN=GPATCH8 PE=1 SV=2 22 77 1.0E-10
sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus GN=Gpatch8 PE=1 SV=1 22 77 1.0E-10
sp|A2AKY4|Z804A_MOUSE Zinc finger protein 804A OS=Mus musculus GN=Znf804a PE=2 SV=1 22 119 2.0E-10
sp|Q7Z570|Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens GN=ZNF804A PE=1 SV=3 22 119 1.0E-09
sp|A4D1E1|Z804B_HUMAN Zinc finger protein 804B OS=Homo sapiens GN=ZNF804B PE=2 SV=2 18 77 1.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2130
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5632
Ophiocordyceps australis map64 (Brazil) OphauB2|2061
Ophiocordyceps camponoti-floridani Ophcf2|02953
Ophiocordyceps camponoti-rufipedis Ophun1|6295 (this protein)
Ophiocordyceps kimflemingae Ophio5|7226
Ophiocordyceps subramaniannii Hirsu2|2548

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6295
MPPRHQTLPPPQTTSAREAQRSFYCDLCRKGYSRMNEFEAHLSSYDHTHKQRLKEMKAMVRDPNAGARARKAEAK
ADGLISITFDEKDASSAAAPAGAGKPGFKRSGFKSAFGTKETSQPTEAAVKLEGALFVKKKPSKQADGDDDESDT
GDEGYQRYDPRYPTD*
Coding >Ophun1|6295
ATGCCCCCTCGACACCAGACTCTGCCTCCGCCGCAGACGACGTCGGCACGCGAGGCCCAAAGGTCCTTCTACTGC
GATCTTTGCCGCAAGGGTTACTCTCGCATGAACGAGTTTGAAGCACATCTCAGCAGCTATGATCACACTCATAAG
CAGCGTCTCAAGGAAATGAAGGCCATGGTCCGCGATCCCAACGCCGGCGCCCGAGCCCGAAAGGCAGAGGCCAAG
GCGGATGGCCTCATTAGCATCACTTTCGATGAGAAGGACGCGTCGAGCGCCGCAGCTCCTGCTGGTGCGGGAAAA
CCTGGGTTCAAGCGCAGCGGATTCAAGAGCGCTTTTGGCACCAAAGAGACTTCGCAACCGACCGAGGCGGCCGTC
AAGCTGGAGGGGGCTCTGTTCGTCAAGAAGAAGCCGTCGAAGCAGGCTGACGGAGATGACGACGAGAGCGACACC
GGGGACGAGGGCTACCAACGCTACGATCCGCGATATCCCACCGATTGA
Transcript >Ophun1|6295
ATGCCCCCTCGACACCAGACTCTGCCTCCGCCGCAGACGACGTCGGCACGCGAGGCCCAAAGGTCCTTCTACTGC
GATCTTTGCCGCAAGGGTTACTCTCGCATGAACGAGTTTGAAGCACATCTCAGCAGCTATGATCACACTCATAAG
CAGCGTCTCAAGGAAATGAAGGCCATGGTCCGCGATCCCAACGCCGGCGCCCGAGCCCGAAAGGCAGAGGCCAAG
GCGGATGGCCTCATTAGCATCACTTTCGATGAGAAGGACGCGTCGAGCGCCGCAGCTCCTGCTGGTGCGGGAAAA
CCTGGGTTCAAGCGCAGCGGATTCAAGAGCGCTTTTGGCACCAAAGAGACTTCGCAACCGACCGAGGCGGCCGTC
AAGCTGGAGGGGGCTCTGTTCGTCAAGAAGAAGCCGTCGAAGCAGGCTGACGGAGATGACGACGAGAGCGACACC
GGGGACGAGGGCTACCAACGCTACGATCCGCGATATCCCACCGATTGA
Gene >Ophun1|6295
ATGCCCCCTGTGAGCAAGGCCTGACCTCAATCCGTGACATCTACCTATCCTTAATAGGTAGTCAACCCAATGGAA
GCCTCGCTAACCACCCAATCTATAGCGACACCAGACTCTGCCTCCGCCGCAGACGACGTCGGCACGCGAGGCCCA
AAGGTCCTTCTACTGCGATCTTTGCCGCAAGGGTTACTCTCGCATGAACGAGTTTGAAGCACATCTCAGCAGCTA
TGATCACACTCATAAGCAGCGTCTCAAGGAAATGAAGGCCATGGTCCGCGATCCCAACGCCGGCGCCCGAGCCCG
AAAGGCAGAGGCCAAGGCGGATGGCCTCATTAGCATCACTTTCGATGAGAAGGACGCGTCGAGCGCCGCAGCTCC
TGCTGGTGCGGGAAAACCTGGGTTCAAGCGCAGCGGATTCAAGAGCGCTTTTGGCACCAAAGAGACTTCGCAACC
GACCGAGGCGGCCGTCAAGCTGGAGGGGGCTCTGTTCGTCAAGAAGAAGCCGTCGAAGCAGGCTGACGGAGATGA
CGACGAGAGCGACACCGGGGACGAGGGCTACCAACGCTACGATCCGCGATATCCCACCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail