Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6284
Gene name
LocationContig_678:57..1889
Strand+
Gene length (bp)1832
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 2.9E-04 311 368
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 9.7E-05 386 451
PF00400 WD40 WD domain, G-beta repeat 3.6E-03 392 427
PF00400 WD40 WD domain, G-beta repeat 1.8E-02 526 558

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 205 561 2.0E-164
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 205 563 4.0E-119
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 108 561 6.0E-115
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 108 561 7.0E-114
sp|Q9SZA4|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-1 PE=1 SV=1 106 560 5.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 205 561 2.0E-164
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 205 563 4.0E-119
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 108 561 6.0E-115
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 108 561 7.0E-114
sp|Q9SZA4|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-1 PE=1 SV=1 106 560 5.0E-113
sp|P26309|CDC20_YEAST APC/C activator protein CDC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC20 PE=1 SV=2 124 561 7.0E-113
sp|Q9S7I8|CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-2 PE=1 SV=1 118 560 1.0E-112
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 108 561 6.0E-112
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 108 561 1.0E-111
sp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-5 PE=1 SV=2 119 560 6.0E-107
sp|Q9S7H3|CD203_ARATH Cell division cycle 20.3, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-3 PE=3 SV=1 135 560 2.0E-105
sp|Q4PSE4|CDC24_ARATH Cell division cycle 20.4, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-4 PE=2 SV=1 204 560 1.0E-101
sp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1 264 560 2.0E-93
sp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1 257 560 1.0E-91
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 257 564 2.0E-89
sp|Q9R1K5|FZR_MOUSE Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1 131 562 5.0E-88
sp|Q9UM11|FZR_HUMAN Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2 134 562 5.0E-88
sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 214 560 1.0E-87
sp|Q54KM3|CDH1_DICDI Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1 256 560 2.0E-86
sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1 134 563 5.0E-84
sp|F4K5R6|CDC26_ARATH Cell division cycle 20.6, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-6 PE=3 SV=1 293 560 3.0E-76
sp|P53197|CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDH1 PE=1 SV=1 237 567 2.0E-75
sp|Q86Y33|CD20B_HUMAN Cell division cycle protein 20 homolog B OS=Homo sapiens GN=CDC20B PE=1 SV=3 261 560 1.0E-66
sp|O94411|MFR2_SCHPO Meiotic fizzy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr2 PE=1 SV=1 115 560 6.0E-56
sp|Q09786|YA98_SCHPO Uncharacterized WD repeat-containing protein C13G6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.08 PE=3 SV=1 261 562 2.0E-52
sp|P50082|AMA1_YEAST Meiosis-specific APC/C activator protein AMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMA1 PE=1 SV=2 194 570 8.0E-45
sp|Q09373|FZY1_CAEEL WD repeat-containing protein fzy-1 OS=Caenorhabditis elegans GN=fzy-1 PE=3 SV=2 220 560 8.0E-36
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 284 557 4.0E-18
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 286 589 3.0E-13
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 286 557 7.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 286 574 2.0E-12
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 319 557 2.0E-12
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 294 559 3.0E-12
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 294 589 5.0E-12
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 319 559 2.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 296 557 2.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 292 576 2.0E-11
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 281 557 2.0E-11
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 281 557 2.0E-11
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 395 589 3.0E-11
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 284 559 3.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 297 563 3.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 294 557 4.0E-11
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 281 557 4.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 286 589 8.0E-11
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 281 557 8.0E-11
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 340 589 9.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 294 565 2.0E-10
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 284 557 3.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 319 563 1.0E-09
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 319 559 1.0E-09
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 340 557 1.0E-09
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 370 559 2.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 395 563 2.0E-09
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 280 473 2.0E-09
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 306 558 3.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 294 559 4.0E-09
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 289 487 5.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 294 557 6.0E-09
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 296 558 6.0E-09
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 330 557 6.0E-09
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 327 560 6.0E-09
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 297 557 6.0E-09
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 327 559 6.0E-09
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 294 559 7.0E-09
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 318 557 1.0E-08
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 327 559 1.0E-08
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 280 484 1.0E-08
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 328 480 1.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 290 557 2.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 290 559 2.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 319 559 2.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 286 558 2.0E-08
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 328 579 2.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 280 473 2.0E-08
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 294 564 2.0E-08
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 319 428 2.0E-08
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 322 461 2.0E-08
sp|O82266|SWA1_ARATH Protein SLOW WALKER 1 OS=Arabidopsis thaliana GN=SWA1 PE=2 SV=1 319 493 2.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 286 492 3.0E-08
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 334 565 3.0E-08
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 322 461 3.0E-08
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 257 565 3.0E-08
sp|A1C6X5|SEC31_ASPCL Protein transport protein sec31 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec31 PE=3 SV=1 331 507 3.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 286 560 4.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 294 589 4.0E-08
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 319 559 4.0E-08
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 257 565 4.0E-08
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 340 557 4.0E-08
sp|O02482|UNC37_CAEEL Transcription factor unc-37 OS=Caenorhabditis elegans GN=unc-37 PE=1 SV=1 304 559 5.0E-08
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 340 557 5.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 319 428 5.0E-08
sp|A1DHK2|SEC31_NEOFI Protein transport protein sec31 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec31 PE=3 SV=1 331 507 5.0E-08
sp|O13637|SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec31 PE=1 SV=1 334 494 6.0E-08
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 296 558 6.0E-08
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 294 564 8.0E-08
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 319 473 8.0E-08
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 316 559 9.0E-08
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 319 557 9.0E-08
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 327 559 9.0E-08
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 334 559 9.0E-08
sp|Q9XGN1|TTG1_ARATH Protein TRANSPARENT TESTA GLABRA 1 OS=Arabidopsis thaliana GN=TTG1 PE=1 SV=1 335 495 1.0E-07
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 319 558 1.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 296 558 1.0E-07
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 340 579 1.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 312 557 2.0E-07
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 340 579 2.0E-07
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 340 576 2.0E-07
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 319 563 2.0E-07
sp|Q4X0M4|SEC31_ASPFU Protein transport protein sec31 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec31 PE=3 SV=1 331 507 2.0E-07
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 242 558 2.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 296 558 3.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 296 558 3.0E-07
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 257 565 3.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 395 557 4.0E-07
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 319 579 4.0E-07
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 395 558 4.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 340 551 5.0E-07
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 319 553 5.0E-07
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 214 567 5.0E-07
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 319 557 5.0E-07
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 319 557 6.0E-07
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 297 558 7.0E-07
sp|Q7ZW33|UTP15_DANRE U3 small nucleolar RNA-associated protein 15 homolog OS=Danio rerio GN=utp15 PE=2 SV=1 340 557 7.0E-07
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 312 558 9.0E-07
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 312 558 9.0E-07
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 280 484 9.0E-07
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 313 559 9.0E-07
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 278 557 1.0E-06
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 340 557 1.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 297 558 1.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 315 558 1.0E-06
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 350 559 1.0E-06
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 338 507 1.0E-06
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 274 565 1.0E-06
sp|Q91WM3|U3IP2_MOUSE U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1 398 563 1.0E-06
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 319 579 1.0E-06
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 280 484 1.0E-06
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 319 557 2.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 280 473 2.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 328 551 2.0E-06
sp|A2QBZ0|SEC31_ASPNC Protein transport protein sec31 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec31 PE=3 SV=1 331 507 2.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 398 559 2.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 334 557 2.0E-06
sp|Q10282|GBB_SCHPO Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 319 557 2.0E-06
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 312 557 2.0E-06
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 318 452 2.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 328 557 3.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 385 561 3.0E-06
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 340 576 3.0E-06
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 284 430 3.0E-06
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 312 557 3.0E-06
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 297 558 3.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 297 558 3.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 297 558 3.0E-06
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 297 558 3.0E-06
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 319 475 3.0E-06
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 297 558 3.0E-06
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 349 558 3.0E-06
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 297 558 3.0E-06
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 297 558 3.0E-06
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 297 558 3.0E-06
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 221 557 4.0E-06
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 285 557 4.0E-06
sp|Q75LV5|YAO_ORYSJ U3 snoRNP-associated protein-like YAOH OS=Oryza sativa subsp. japonica GN=Os03g0625900 PE=2 SV=1 399 563 4.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 297 558 4.0E-06
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 319 563 4.0E-06
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 294 558 4.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 297 558 5.0E-06
sp|Q54LT8|STRAP_DICDI Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1 396 565 5.0E-06
sp|Q5SQM0|EMAL6_MOUSE Echinoderm microtubule-associated protein-like 6 OS=Mus musculus GN=Eml6 PE=2 SV=1 398 557 5.0E-06
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 328 551 6.0E-06
sp|O43818|U3IP2_HUMAN U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1 398 563 6.0E-06
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 297 558 6.0E-06
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 331 515 6.0E-06
sp|Q2GVT8|SEC31_CHAGB Protein transport protein SEC31 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC31 PE=3 SV=1 338 507 6.0E-06
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 299 557 7.0E-06
sp|Q5S580|SEC31_AJECA Protein transport protein SEC31 OS=Ajellomyces capsulatus GN=SEC31 PE=1 SV=1 361 507 7.0E-06
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 397 557 7.0E-06
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 395 563 8.0E-06
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 328 559 8.0E-06
sp|Q5AZM3|SEC31_EMENI Protein transport protein sec31 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec31 PE=3 SV=2 331 477 8.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 297 558 8.0E-06
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 297 558 8.0E-06
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 319 475 8.0E-06
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 221 557 9.0E-06
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 296 563 9.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 297 558 9.0E-06
sp|Q9Z1Z2|STRAP_MOUSE Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 342 564 9.0E-06
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 393 559 9.0E-06
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 393 559 9.0E-06
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 284 430 1.0E-05
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 385 561 1.0E-05
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 294 442 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2209
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6361
Ophiocordyceps australis map64 (Brazil) OphauB2|1894
Ophiocordyceps camponoti-floridani Ophcf2|02298
Ophiocordyceps camponoti-rufipedis Ophun1|6284 (this protein)
Ophiocordyceps kimflemingae Ophio5|7877
Ophiocordyceps subramaniannii Hirsu2|2793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6284
MATASVSTPIKSHRGLFATRTAGGRMPLTPSPRQPSTNTTVPFNLGSSPFSPENRPANECRVASRSTYSGSFLSR
VRESPKSNIARDSQTPRKALELGVSDFTLTGTGKTPASSKTKKCPLRQKSLKTTLSYSGDRFIPNRGASSAMTNP
GSTKLSLDRPRSRNNESSSILSAAADEAAAALEGLSINDSKAEDYTRPSPNTAAYQDSLADACGVNLSTRILEFK
PAPPESSKPIDLRQQYNRPLKPASAASAQLRRRVPMAPERVLDAPGLIDDYYLNLLDWSSGNQVAIGLERNVYVW
SADVGSVSCLLESPADTYVSSVKWSEDGAYVGVGLGTGEVQIWDVAERQKIRSMFGHDTRVGVMGWSKHLLSTGA
RSGLVFNHDVRIAEHKVAELVSHTSEVCGLEWRTDGMQLATGGNDNLVSIWDARSLSVPKFTKTNHKAAVKALAW
CPWNMNLLATGGGAYDRHIHFWNSSSGARVNSIDTGSQVTSLRWSQHYREIVSSSGFPSNSLSIWSYPTLVRTVE
LNAHESRVLHSCLSPDGQMLATAAADESLKFWKVFEKKTGAVGSLGSAAANAKAAERAKQMTIR*
Coding >Ophun1|6284
ATGGCTACCGCATCAGTATCGACACCCATCAAGTCCCACAGGGGGCTCTTCGCCACACGGACGGCCGGCGGCCGG
ATGCCCCTGACCCCCTCCCCTCGCCAGCCTTCGACAAATACCACAGTTCCTTTCAACCTGGGCTCGTCTCCCTTC
AGCCCGGAGAACCGGCCGGCCAACGAGTGCCGCGTGGCCTCCAGATCCACGTACAGCGGCAGTTTCTTGTCGCGC
GTGCGGGAGTCGCCCAAGTCAAACATCGCCCGCGATTCTCAGACACCGCGCAAAGCCCTGGAGCTGGGCGTTTCC
GACTTCACCCTCACTGGCACTGGCAAGACTCCCGCCAGCTCCAAGACCAAGAAATGCCCGCTGCGGCAGAAGTCG
CTCAAGACGACGCTGAGCTACAGCGGGGACCGCTTCATTCCGAACCGGGGCGCCAGTTCGGCCATGACCAACCCT
GGATCGACCAAGCTGAGCCTCGACCGGCCACGCAGCAGGAACAATGAGAGCTCGTCGATACTGTCGGCAGCAGCT
GACGAGGCCGCCGCGGCTCTCGAGGGCCTCAGTATCAATGACAGTAAGGCTGAAGATTACACGCGGCCGTCGCCC
AACACGGCCGCGTACCAGGACTCCCTGGCAGACGCCTGCGGTGTCAACCTGAGCACTCGCATCCTCGAGTTCAAG
CCAGCGCCACCCGAGTCGTCGAAACCCATCGACCTCAGGCAGCAGTATAACAGGCCGCTCAAGCCCGCCAGCGCA
GCCTCGGCTCAGTTGCGTCGGCGTGTTCCCATGGCGCCGGAGCGCGTGCTCGACGCGCCGGGCCTCATCGACGAC
TACTACCTCAACCTGCTCGACTGGAGCTCGGGCAATCAAGTGGCCATCGGCCTAGAGCGCAACGTCTACGTCTGG
TCGGCCGACGTGGGTAGCGTCAGCTGCCTGCTCGAGAGCCCCGCGGACACGTATGTTAGCAGCGTCAAGTGGTCC
GAGGATGGCGCCTATGTCGGCGTCGGGCTGGGCACGGGCGAGGTTCAGATCTGGGACGTGGCGGAGCGCCAGAAG
ATCCGCAGCATGTTCGGCCACGATACGCGCGTCGGCGTCATGGGGTGGAGCAAGCACCTGCTGTCGACGGGCGCA
CGGAGCGGACTCGTCTTCAACCATGATGTCCGGATCGCGGAGCACAAGGTGGCCGAGCTCGTGTCACACACGTCG
GAAGTGTGTGGGCTGGAGTGGCGGACCGACGGGATGCAGCTTGCGACGGGGGGCAACGACAACCTGGTATCCATC
TGGGACGCCCGCTCGCTCTCAGTGCCCAAGTTCACCAAGACGAACCACAAGGCGGCCGTCAAGGCACTCGCCTGG
TGCCCGTGGAACATGAACCTGCTGGCGACGGGCGGCGGCGCGTACGACCGCCACATTCACTTCTGGAACTCGTCT
TCAGGCGCGCGCGTCAACAGCATCGACACCGGGTCTCAAGTCACGTCGCTTCGATGGAGCCAGCACTATCGCGAG
ATTGTCAGCTCGAGCGGCTTCCCGTCCAACTCGCTCAGCATCTGGAGCTATCCGACGCTGGTGCGGACGGTCGAG
CTCAATGCGCACGAGAGCCGGGTGTTGCACAGCTGCCTCAGCCCCGACGGCCAGATGCTGGCCACAGCTGCGGCC
GACGAGAGCCTCAAGTTCTGGAAGGTCTTTGAGAAGAAGACGGGCGCCGTCGGCAGTCTCGGAAGCGCTGCGGCC
AACGCCAAGGCAGCCGAAAGGGCCAAGCAGATGACGATCCGATAG
Transcript >Ophun1|6284
ATGGCTACCGCATCAGTATCGACACCCATCAAGTCCCACAGGGGGCTCTTCGCCACACGGACGGCCGGCGGCCGG
ATGCCCCTGACCCCCTCCCCTCGCCAGCCTTCGACAAATACCACAGTTCCTTTCAACCTGGGCTCGTCTCCCTTC
AGCCCGGAGAACCGGCCGGCCAACGAGTGCCGCGTGGCCTCCAGATCCACGTACAGCGGCAGTTTCTTGTCGCGC
GTGCGGGAGTCGCCCAAGTCAAACATCGCCCGCGATTCTCAGACACCGCGCAAAGCCCTGGAGCTGGGCGTTTCC
GACTTCACCCTCACTGGCACTGGCAAGACTCCCGCCAGCTCCAAGACCAAGAAATGCCCGCTGCGGCAGAAGTCG
CTCAAGACGACGCTGAGCTACAGCGGGGACCGCTTCATTCCGAACCGGGGCGCCAGTTCGGCCATGACCAACCCT
GGATCGACCAAGCTGAGCCTCGACCGGCCACGCAGCAGGAACAATGAGAGCTCGTCGATACTGTCGGCAGCAGCT
GACGAGGCCGCCGCGGCTCTCGAGGGCCTCAGTATCAATGACAGTAAGGCTGAAGATTACACGCGGCCGTCGCCC
AACACGGCCGCGTACCAGGACTCCCTGGCAGACGCCTGCGGTGTCAACCTGAGCACTCGCATCCTCGAGTTCAAG
CCAGCGCCACCCGAGTCGTCGAAACCCATCGACCTCAGGCAGCAGTATAACAGGCCGCTCAAGCCCGCCAGCGCA
GCCTCGGCTCAGTTGCGTCGGCGTGTTCCCATGGCGCCGGAGCGCGTGCTCGACGCGCCGGGCCTCATCGACGAC
TACTACCTCAACCTGCTCGACTGGAGCTCGGGCAATCAAGTGGCCATCGGCCTAGAGCGCAACGTCTACGTCTGG
TCGGCCGACGTGGGTAGCGTCAGCTGCCTGCTCGAGAGCCCCGCGGACACGTATGTTAGCAGCGTCAAGTGGTCC
GAGGATGGCGCCTATGTCGGCGTCGGGCTGGGCACGGGCGAGGTTCAGATCTGGGACGTGGCGGAGCGCCAGAAG
ATCCGCAGCATGTTCGGCCACGATACGCGCGTCGGCGTCATGGGGTGGAGCAAGCACCTGCTGTCGACGGGCGCA
CGGAGCGGACTCGTCTTCAACCATGATGTCCGGATCGCGGAGCACAAGGTGGCCGAGCTCGTGTCACACACGTCG
GAAGTGTGTGGGCTGGAGTGGCGGACCGACGGGATGCAGCTTGCGACGGGGGGCAACGACAACCTGGTATCCATC
TGGGACGCCCGCTCGCTCTCAGTGCCCAAGTTCACCAAGACGAACCACAAGGCGGCCGTCAAGGCACTCGCCTGG
TGCCCGTGGAACATGAACCTGCTGGCGACGGGCGGCGGCGCGTACGACCGCCACATTCACTTCTGGAACTCGTCT
TCAGGCGCGCGCGTCAACAGCATCGACACCGGGTCTCAAGTCACGTCGCTTCGATGGAGCCAGCACTATCGCGAG
ATTGTCAGCTCGAGCGGCTTCCCGTCCAACTCGCTCAGCATCTGGAGCTATCCGACGCTGGTGCGGACGGTCGAG
CTCAATGCGCACGAGAGCCGGGTGTTGCACAGCTGCCTCAGCCCCGACGGCCAGATGCTGGCCACAGCTGCGGCC
GACGAGAGCCTCAAGTTCTGGAAGGTCTTTGAGAAGAAGACGGGCGCCGTCGGCAGTCTCGGAAGCGCTGCGGCC
AACGCCAAGGCAGCCGAAAGGGCCAAGCAGATGACGATCCGATAG
Gene >Ophun1|6284
ATGGCTACCGCATCAGTATCGACACCCATCAAGTCCCACAGGGGGCTCTTCGCCACACGGACGGCCGGCGGCCGG
ATGCCCCTGACCCCCTCCCCTCGCCAGCCTTCGACAAATACCACAGTTCCTTTCAACCTGGGCTCGTCTCCCTTC
AGCCCGGAGAACCGGCCGGCCAACGAGTGCCGCGTGGCCTCCAGATCCACGTACAGCGGCAGTTTCTTGTCGCGC
GTGCGGGAGTCGCCCAAGTCAAACATCGCCCGCGATTCTCAGACACCGCGCAAAGCCCTGGAGCTGGGCGTTTCC
GACTTCACCCTCACTGGCACTGGCAAGACTCCCGCCAGCTCCAAGACCAAGAAATGCCCGCTGCGGCAGAAGTCG
CTCAAGACGACGCTGAGCTACAGCGGGGACCGCTTCATTCCGAACCGGGGCGCCAGTTCGGCCATGACCAACCCT
GGATCGACCAAGCTGAGCCTCGACCGGCCACGCAGCAGGAACAATGAGAGCTCGTCGATACTGTCGGCAGCAGCT
GACGAGGCCGCCGCGGCTCTCGAGGGCCTCAGTATCAATGACAGTAAGGCTGAAGATTACACGCGGCCGTCGCCC
AACACGGCCGCGTACCAGGACTCCCTGGCAGACGCCTGCGGTGTCAACCTGAGCACTCGCATCCTCGAGTTCAAG
CCAGCGCCACCCGAGTCGTCGAAACCCATCGACCTCAGGCAGCAGTATAACAGGCCGCTCAAGCCCGCCAGCGCA
GCCTCGGCTCAGTTGCGTCGGCGTGTTCCCATGGCGCCGGAGCGCGTGCTCGACGCGCCGGGCCTCATCGACGAC
TACTACCTCAACCTGCTCGACTGGAGCTCGGGCAATCAAGTGGCCATCGGCCTAGAGCGCAACGTCTACGTCTGG
TCGGCCGACGTGGGTAGCGTCAGCTGCCTGCTCGAGAGCCCCGCGGACACGTATGTTAGCAGCGTCAAGTGGTCC
GAGGATGGCGCCTATGTCGGCGTCGGGCTGGGCACGGGCGAGGTTCAGATCTGGGACGTGGCGGAGCGCCAGAAG
ATCCGCAGCATGTTCGGCCACGATACGCGCGTCGGCGTCATGGGGTGGAGCAAGCACCTGCTGTCGACGGGCGCA
CGGAGCGGACTCGTCTTCAACCATGATGTCCGGATCGCGGAGCACAAGGTGGCCGAGCTCGTGTCACACACGTCG
GAAGTGTGTGGGCTGGAGTGGCGGACCGACGGGATGCAGCTTGCGACGGGGGGCAACGACAACCTGGTATCCATC
TGGGACGCCCGCTCGCTCTCAGTGCCCAAGTTCACCAAGACGAACCACAAGGCGGCCGTCAAGGCACTCGCCTGG
TGCCCGTGGAACATGAACCTGCTGGCGACGGGCGGCGGCGCGTACGACCGCCACATTCACTTCTGGAACTCGTCT
TCAGGCGCGCGCGTCAACAGCATCGACACCGGGTCTCAAGTCACGTCGCTTCGATGGAGCCAGCACTATCGCGAG
ATTGTCAGCTCGAGCGGCTTCCCGTCCAACTCGCTCAGCATCTGGAGCTATCCGACGCTGGTGCGGACGGTCGAG
CTCAATGCGCACGAGAGCCGGGTGTTGCACAGCTGCCTCAGCCCCGACGGCCAGATGCTGGCCACAGCTGGTATG
TGTGACGTCAAAGCTACCCCCGCCGGAACCAGAAAGACTAACATCATGTGTTCGCAGCGGCCGACGAGAGCCTCA
AGTTCTGGAAGGTCTTTGAGAAGAAGACGGGCGCCGTCGGCAGTCTCGGAAGCGCTGCGGCCAACGCCAAGGCAG
CCGAAAGGGCCAAGCAGATGACGATCCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail