Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6278
Gene name
LocationContig_676:4940..6603
Strand+
Gene length (bp)1663
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 5.7E-02 261 291
PF00400 WD40 WD domain, G-beta repeat 5.1E-02 296 330
PF00400 WD40 WD domain, G-beta repeat 3.4E-03 390 427
PF11715 Nup160 Nucleoporin Nup120/160 6.9E-05 246 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P775|YBEG_SCHPO Uncharacterized WD repeat-containing protein C17D11.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.16 PE=1 SV=1 1 507 4.0E-156
sp|P21304|PWP1_YEAST Periodic tryptophan protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP1 PE=1 SV=1 3 504 3.0E-112
sp|Q99LL5|PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus GN=Pwp1 PE=1 SV=1 4 488 2.0E-87
sp|Q2HJ56|PWP1_BOVIN Periodic tryptophan protein 1 homolog OS=Bos taurus GN=PWP1 PE=2 SV=1 4 498 1.0E-86
sp|Q13610|PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens GN=PWP1 PE=1 SV=1 4 488 8.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P775|YBEG_SCHPO Uncharacterized WD repeat-containing protein C17D11.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.16 PE=1 SV=1 1 507 4.0E-156
sp|P21304|PWP1_YEAST Periodic tryptophan protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP1 PE=1 SV=1 3 504 3.0E-112
sp|Q99LL5|PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus GN=Pwp1 PE=1 SV=1 4 488 2.0E-87
sp|Q2HJ56|PWP1_BOVIN Periodic tryptophan protein 1 homolog OS=Bos taurus GN=PWP1 PE=2 SV=1 4 498 1.0E-86
sp|Q13610|PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens GN=PWP1 PE=1 SV=1 4 488 8.0E-86
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 184 487 1.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 204 503 2.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 184 487 5.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 277 481 1.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 184 487 3.0E-11
sp|Q29RH4|THOC3_BOVIN THO complex subunit 3 OS=Bos taurus GN=THOC3 PE=2 SV=1 246 428 6.0E-11
sp|Q8VE80|THOC3_MOUSE THO complex subunit 3 OS=Mus musculus GN=Thoc3 PE=2 SV=1 246 428 7.0E-11
sp|Q96J01|THOC3_HUMAN THO complex subunit 3 OS=Homo sapiens GN=THOC3 PE=1 SV=1 246 428 8.0E-11
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 276 481 9.0E-11
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 261 339 9.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 207 498 3.0E-10
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 277 426 5.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 204 428 2.0E-09
sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 267 433 2.0E-09
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 207 482 2.0E-09
sp|Q6CSI1|HAT2_KLULA Histone acetyltransferase type B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT2 PE=3 SV=1 248 432 2.0E-09
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 204 428 3.0E-09
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 204 428 3.0E-09
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 204 428 3.0E-09
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 204 428 3.0E-09
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 204 428 3.0E-09
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 204 428 3.0E-09
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 204 428 3.0E-09
sp|P33750|DCA13_YEAST Protein SOF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOF1 PE=1 SV=1 273 473 3.0E-09
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 204 428 3.0E-09
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 204 428 4.0E-09
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 204 428 4.0E-09
sp|Q7S7N3|HAT2_NEUCR Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 261 339 5.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 277 487 6.0E-09
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 261 482 6.0E-09
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 276 474 6.0E-09
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 204 428 6.0E-09
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 261 339 7.0E-09
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 204 428 7.0E-09
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 276 428 7.0E-09
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 261 339 9.0E-09
sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1 267 433 1.0E-08
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 259 487 1.0E-08
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 204 428 1.0E-08
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 261 482 1.0E-08
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 261 482 2.0E-08
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 204 503 2.0E-08
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 276 428 2.0E-08
sp|O74340|DCA13_SCHPO Protein sof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sof1 PE=3 SV=1 281 528 2.0E-08
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 204 426 2.0E-08
sp|Q75C99|HAT2_ASHGO Histone acetyltransferase type B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAT2 PE=3 SV=1 200 432 3.0E-08
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 204 428 4.0E-08
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 259 487 5.0E-08
sp|Q6FXI8|HAT2_CANGA Histone acetyltransferase type B subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAT2 PE=3 SV=1 259 432 6.0E-08
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 273 435 6.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 204 484 9.0E-08
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 261 482 9.0E-08
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 219 432 1.0E-07
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 204 428 1.0E-07
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 275 448 1.0E-07
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 206 426 1.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 216 477 1.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 276 487 2.0E-07
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 277 426 2.0E-07
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 259 487 2.0E-07
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 202 487 2.0E-07
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 259 487 2.0E-07
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 159 428 2.0E-07
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 195 487 3.0E-07
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 276 429 3.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 204 473 3.0E-07
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 276 476 3.0E-07
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 266 432 4.0E-07
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 195 487 4.0E-07
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 202 487 4.0E-07
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 195 487 5.0E-07
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 277 481 5.0E-07
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 276 435 5.0E-07
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 276 429 5.0E-07
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 259 487 6.0E-07
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 219 331 6.0E-07
sp|Q5ZMV9|WDR24_CHICK WD repeat-containing protein 24 OS=Gallus gallus GN=WDR24 PE=2 SV=1 276 485 6.0E-07
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 261 482 7.0E-07
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 261 518 7.0E-07
sp|Q9FKT5|THOC3_ARATH THO complex subunit 3 OS=Arabidopsis thaliana GN=THO3 PE=1 SV=1 202 429 7.0E-07
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 277 426 1.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 261 487 1.0E-06
sp|P53197|CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDH1 PE=1 SV=1 278 431 1.0E-06
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 206 421 1.0E-06
sp|Q54DS4|Y2056_DICDI WD repeat-containing protein DDB_G0292056 OS=Dictyostelium discoideum GN=DDB_G0292056 PE=3 SV=1 271 478 1.0E-06
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 275 426 1.0E-06
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 137 488 1.0E-06
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 195 487 1.0E-06
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 204 426 1.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 204 428 1.0E-06
sp|Q54SD4|RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum GN=rbbD PE=3 SV=1 254 476 1.0E-06
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 278 428 2.0E-06
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 259 339 2.0E-06
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 278 432 2.0E-06
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 261 482 2.0E-06
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 276 460 2.0E-06
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 293 476 2.0E-06
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 205 487 2.0E-06
sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 263 428 2.0E-06
sp|Q7ZX22|WDR24_XENLA WD repeat-containing protein 24 OS=Xenopus laevis GN=wdr24 PE=2 SV=1 276 428 2.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 207 487 3.0E-06
sp|P14197|AAC3_DICDI WD repeat-containing protein AAC3 OS=Dictyostelium discoideum GN=AAC3 PE=2 SV=2 261 491 3.0E-06
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 188 428 3.0E-06
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 195 487 3.0E-06
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 195 487 3.0E-06
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 195 487 3.0E-06
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 195 487 3.0E-06
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 205 337 3.0E-06
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 195 487 3.0E-06
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 277 469 3.0E-06
sp|P93563|GBB_SOLTU Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1 278 379 3.0E-06
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 205 337 3.0E-06
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 204 426 3.0E-06
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 263 428 3.0E-06
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 188 428 3.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 261 481 3.0E-06
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 238 487 3.0E-06
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 188 428 4.0E-06
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 188 428 4.0E-06
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 261 474 4.0E-06
sp|Q75AV4|PFS2_ASHGO Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 277 426 4.0E-06
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 276 428 4.0E-06
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 188 428 5.0E-06
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 261 474 5.0E-06
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 275 432 5.0E-06
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 188 428 5.0E-06
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 263 428 6.0E-06
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 261 488 6.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 201 487 7.0E-06
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 276 431 7.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 261 473 7.0E-06
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 278 488 7.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 261 474 7.0E-06
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 259 487 8.0E-06
sp|Q7S7N3|HAT2_NEUCR Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 182 432 1.0E-05
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 261 482 1.0E-05
sp|Q24572|CAF1_DROME Probable histone-binding protein Caf1 OS=Drosophila melanogaster GN=Caf1 PE=1 SV=1 304 476 1.0E-05
sp|Q6LA54|YF48_SCHPO Uncharacterized WD repeat-containing protein C3H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.08c PE=1 SV=2 204 379 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1029
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2571
Ophiocordyceps australis 1348a (Ghana) OphauG2|7862
Ophiocordyceps australis map64 (Brazil) OphauB2|2148
Ophiocordyceps camponoti-floridani Ophcf2|00262
Ophiocordyceps camponoti-rufipedis Ophun1|6278 (this protein)
Ophiocordyceps kimflemingae Ophio5|6071
Ophiocordyceps subramaniannii Hirsu2|9347

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6278
MSIITTAQWVPRGFAAPFPKKYTLDEAEFDRIASLAQLQLDDAREDLKAAEIVDEGVKEDSPQADAHSRTSKDDD
LKEYDLEHYDDDDDEKEANEKGQTMGMFGNVKSLAYYESNEDDPYITLQGDDDDDDDDRQDLQIMATDNLILSAK
VEDELAQLEVYVFEDEGDNLYVHHDLMLPAIPLCLEWLDMPVGSRKGTVEAARGSYVAVGTMDPDIEIWDLDTID
SMYPDAILGQGDSTDKDKKKLKKKKKKSKRANDEYHVDAVLSLAANRSHRNLLASASADQTVKLWDVNTVKCAQS
YSYHTDKVCSLAWSATEATVLLSGSYDRTVVAADMRAPGAKVPRWGVESDVENVRWDPHDGNMFFVSTDKGAVHY
HDVRQAPRNVEATKSVWTLQAHDESVSSLDVNAVIPGFMATGSTDRTVKLWNVTATGPSMVVSRNLDVGKVFAAT
FAPDAAVAFRLAVAGSSGSMHVWDTSTNAAVRKVFAHRMMPGRSETAAEDRLVGVEEDEEDEDEDEDENDGGSSG
QGSRGDSMDED*
Coding >Ophun1|6278
ATGTCCATCATTACTACTGCGCAATGGGTTCCGCGTGGCTTCGCGGCGCCTTTCCCTAAAAAGTACACCCTCGAC
GAGGCCGAGTTCGACAGGATAGCGTCGCTGGCTCAGCTGCAGCTCGATGACGCCCGCGAAGACTTGAAGGCGGCA
GAGATCGTCGACGAGGGCGTGAAGGAAGACTCGCCGCAGGCGGATGCCCACAGCAGGACCTCGAAGGATGACGAC
TTGAAAGAGTACGATCTAGAACACTACGACGACGACGACGACGAGAAAGAGGCGAATGAAAAAGGTCAGACCATG
GGCATGTTTGGGAATGTCAAGTCTCTCGCCTACTACGAGTCCAACGAGGATGATCCGTATATTACGCTGCAGGGT
GACGACGACGACGACGACGACGATCGGCAAGATCTCCAGATCATGGCTACCGACAATCTCATCCTGTCGGCCAAG
GTCGAAGATGAGCTGGCGCAACTAGAGGTGTACGTGTTTGAGGACGAAGGGGACAATCTCTACGTCCACCACGAC
CTGATGCTTCCCGCGATACCGCTGTGTCTCGAATGGCTAGACATGCCCGTGGGCAGCAGAAAGGGCACCGTCGAG
GCCGCGAGAGGGAGCTACGTCGCCGTCGGAACCATGGATCCGGACATTGAGATATGGGATCTCGACACCATCGAC
AGCATGTATCCCGACGCCATCCTCGGCCAAGGCGACTCGACAGACAAGGACAAGAAGAAGCTCAAGAAGAAGAAG
AAGAAGAGTAAGCGGGCCAACGACGAGTACCACGTCGACGCTGTGCTCTCGCTGGCGGCCAACCGCAGCCACCGC
AACCTGCTCGCGTCGGCGTCGGCAGACCAGACGGTCAAGCTCTGGGACGTCAACACGGTCAAGTGCGCCCAGTCG
TACTCGTACCACACGGACAAGGTGTGCTCGCTGGCGTGGAGCGCAACGGAGGCGACGGTGCTGCTGAGCGGGAGC
TACGACAGGACCGTGGTAGCGGCCGACATGCGGGCGCCGGGGGCCAAGGTGCCGCGATGGGGCGTGGAGAGCGAC
GTGGAGAACGTTCGATGGGATCCGCACGACGGCAACATGTTCTTTGTCTCGACGGACAAGGGAGCGGTGCACTAC
CACGACGTGCGCCAAGCGCCGCGGAACGTCGAGGCGACCAAGTCGGTGTGGACTCTTCAGGCGCACGACGAGTCG
GTATCGTCGCTCGACGTCAACGCCGTCATCCCGGGCTTCATGGCGACGGGGTCGACGGACAGGACGGTCAAGCTG
TGGAACGTGACGGCCACGGGCCCATCCATGGTGGTATCGCGCAACCTGGATGTGGGCAAGGTGTTTGCGGCGACG
TTTGCTCCGGATGCCGCCGTTGCCTTCCGGCTGGCCGTGGCCGGGAGCTCTGGAAGCATGCACGTTTGGGACACG
AGCACCAACGCGGCCGTCCGCAAGGTCTTTGCCCACCGGATGATGCCCGGGCGGAGCGAGACGGCGGCCGAGGAC
CGGCTGGTGGGCGTCGAGGAGGATGAGGAGGACGAGGATGAGGATGAGGACGAGAACGATGGCGGCAGCTCGGGC
CAAGGGTCCAGGGGGGACTCGATGGACGAGGACTGA
Transcript >Ophun1|6278
ATGTCCATCATTACTACTGCGCAATGGGTTCCGCGTGGCTTCGCGGCGCCTTTCCCTAAAAAGTACACCCTCGAC
GAGGCCGAGTTCGACAGGATAGCGTCGCTGGCTCAGCTGCAGCTCGATGACGCCCGCGAAGACTTGAAGGCGGCA
GAGATCGTCGACGAGGGCGTGAAGGAAGACTCGCCGCAGGCGGATGCCCACAGCAGGACCTCGAAGGATGACGAC
TTGAAAGAGTACGATCTAGAACACTACGACGACGACGACGACGAGAAAGAGGCGAATGAAAAAGGTCAGACCATG
GGCATGTTTGGGAATGTCAAGTCTCTCGCCTACTACGAGTCCAACGAGGATGATCCGTATATTACGCTGCAGGGT
GACGACGACGACGACGACGACGATCGGCAAGATCTCCAGATCATGGCTACCGACAATCTCATCCTGTCGGCCAAG
GTCGAAGATGAGCTGGCGCAACTAGAGGTGTACGTGTTTGAGGACGAAGGGGACAATCTCTACGTCCACCACGAC
CTGATGCTTCCCGCGATACCGCTGTGTCTCGAATGGCTAGACATGCCCGTGGGCAGCAGAAAGGGCACCGTCGAG
GCCGCGAGAGGGAGCTACGTCGCCGTCGGAACCATGGATCCGGACATTGAGATATGGGATCTCGACACCATCGAC
AGCATGTATCCCGACGCCATCCTCGGCCAAGGCGACTCGACAGACAAGGACAAGAAGAAGCTCAAGAAGAAGAAG
AAGAAGAGTAAGCGGGCCAACGACGAGTACCACGTCGACGCTGTGCTCTCGCTGGCGGCCAACCGCAGCCACCGC
AACCTGCTCGCGTCGGCGTCGGCAGACCAGACGGTCAAGCTCTGGGACGTCAACACGGTCAAGTGCGCCCAGTCG
TACTCGTACCACACGGACAAGGTGTGCTCGCTGGCGTGGAGCGCAACGGAGGCGACGGTGCTGCTGAGCGGGAGC
TACGACAGGACCGTGGTAGCGGCCGACATGCGGGCGCCGGGGGCCAAGGTGCCGCGATGGGGCGTGGAGAGCGAC
GTGGAGAACGTTCGATGGGATCCGCACGACGGCAACATGTTCTTTGTCTCGACGGACAAGGGAGCGGTGCACTAC
CACGACGTGCGCCAAGCGCCGCGGAACGTCGAGGCGACCAAGTCGGTGTGGACTCTTCAGGCGCACGACGAGTCG
GTATCGTCGCTCGACGTCAACGCCGTCATCCCGGGCTTCATGGCGACGGGGTCGACGGACAGGACGGTCAAGCTG
TGGAACGTGACGGCCACGGGCCCATCCATGGTGGTATCGCGCAACCTGGATGTGGGCAAGGTGTTTGCGGCGACG
TTTGCTCCGGATGCCGCCGTTGCCTTCCGGCTGGCCGTGGCCGGGAGCTCTGGAAGCATGCACGTTTGGGACACG
AGCACCAACGCGGCCGTCCGCAAGGTCTTTGCCCACCGGATGATGCCCGGGCGGAGCGAGACGGCGGCCGAGGAC
CGGCTGGTGGGCGTCGAGGAGGATGAGGAGGACGAGGATGAGGATGAGGACGAGAACGATGGCGGCAGCTCGGGC
CAAGGGTCCAGGGGGGACTCGATGGACGAGGACTGA
Gene >Ophun1|6278
ATGTCCATCATTACTACTGCGCAATGGGTTCCGCGTGGCTTCGCGGCGCCTTTCCCTAAAAAGTACACCCTCGAC
GAGGCCGAGTTCGACAGGATAGCGTCGCTGGCTCAGCTGCAGCTCGATGACGCCCGCGAAGACTTGAAGGCGGCA
GAGATCGTCGACGAGGGCGTGAAGGAAGACTCGCCGCAGGCGGATGCCCACAGCAGGACGTGGGTTGAGAGCCCT
CTTCTCCACGTAGCTGCGCTGACACTGCCTACTCAGCTCGAAGGATGACGACTTGAAAGAGTACGATCTAGAACA
CTACGACGACGACGACGACGAGAAAGAGGCGAATGAAAAAGGTCAGACCATGGGCATGTTTGGGAATGTCAAGTC
TCTCGCCTACTACGAGTCCAACGAGGATGATCCGTATATTACGCTGCAGGGTGACGACGACGACGACGACGACGA
TCGGCAAGATCTCCAGATCATGGCTACCGACAATCTCATCCTGTCGGCCAAGGTCGAAGATGAGCTGGCGCAACT
AGAGGTGTACGTGTTTGAGGACGAAGGGGACAATCTCTACGTCCACCACGACCTGATGCTTCCCGCGATACCGCT
GTGTCTCGAATGGCTAGACATGCCCGTGGGCAGCAGAAAGGGCACCGTCGAGGCCGCGAGAGGGAGCTACGTCGC
CGTCGGAACCATGGATCCGGACATTGAGATATGGGATCTCGACACCATCGACAGCATGTATCCCGACGCCATCCT
CGGCCAAGGCGACTCGACAGACAAGGACAAGAAGAAGCTCAAGAAGAAGAAGAAGAAGAGTAAGCGGGCCAACGA
CGAGTACCACGTCGACGCTGTGCTCTCGCTGGCGGCCAACCGCAGCCACCGCAACCTGCTCGCGTCGGCGTCGGC
AGACCAGACGGTCAAGCTCTGGGACGTCAACACGGTCAAGTGCGCCCAGTCGTACTCGTACCACACGGACAAGGT
GTGCTCGCTGGCGTGGAGCGCAACGGAGGCGACGGTGCTGCTGAGCGGGAGCTACGACAGGACCGTGGTAGCGGC
CGACATGCGGGCGCCGGGGGCCAAGGTGCCGCGATGGGGCGTGGAGAGCGACGTGGAGAACGTTCGATGGGATCC
GCACGACGGCAACATGTTCTTTGTCTCGACGGACAAGGGAGCGGTGCACTACCACGACGTGCGCCAAGCGCCGCG
GAACGTCGAGGCGACCAAGTCGGTGTGGACTCTTCAGGCGCACGACGAGTCGGTATCGTCGCTCGACGTCAACGC
CGTCATCCCGGGCTTCATGGCGACGGGGTCGACGGACAGGACGGTCAAGCTGTGGAACGTGACGGCCACGGGCCC
ATCCATGGTGGTATCGCGCAACCTGGATGTGGGCAAGGTGTTTGCGGCGACGTTTGCTCCGGATGCCGCCGTTGC
CTTCCGGCTGGCCGTGGCCGGGAGCTCTGGAAGCATGCACGTTTGGGACACGAGCACCAACGCGGCCGTCCGCAA
GGTCTTTGCCCACCGGATGATGCCCGGGCGGAGCGAGACGGCGGCCGAGGACCGGCTGGTGGGCGTCGAGGAGGA
TGAGGAGGACGAGGATGAGGATGAGGACGAGAACGATGGCGGCAGCTCGGGCCAAGGGTCCAGGGGGGACTCGAT
GGACGAGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail