Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6277
Gene name
LocationContig_676:1557..4709
Strand-
Gene length (bp)3152
Transcript length (bp)3012
Coding sequence length (bp)3012
Protein length (aa) 1004

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 2.1E-21 673 756
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 3.6E-18 815 891
PF00271 Helicase_C Helicase conserved C-terminal domain 4.7E-13 481 607
PF00270 DEAD DEAD/DEAH box helicase 1.1E-07 283 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 53 927 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 53 907 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 53 907 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 9 936 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 60 965 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 53 927 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 53 907 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 53 907 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 9 936 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 60 965 0.0E+00
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 170 897 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 120 921 0.0E+00
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 120 921 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 108 912 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 120 896 0.0E+00
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 106 907 0.0E+00
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 120 912 0.0E+00
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 249 906 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 255 898 0.0E+00
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 272 898 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 259 906 0.0E+00
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 258 894 0.0E+00
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 235 898 0.0E+00
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 235 898 0.0E+00
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 268 898 0.0E+00
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 267 898 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 269 916 0.0E+00
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 260 916 0.0E+00
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 270 894 0.0E+00
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 265 910 0.0E+00
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 224 896 0.0E+00
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 264 896 0.0E+00
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 265 896 0.0E+00
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 267 896 0.0E+00
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 267 896 0.0E+00
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 267 894 0.0E+00
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 270 894 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 270 903 0.0E+00
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 243 890 0.0E+00
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 238 902 3.0E-173
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 270 889 3.0E-171
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 270 907 1.0E-170
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 268 904 4.0E-168
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 190 886 2.0E-167
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 279 948 2.0E-167
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 279 948 6.0E-167
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 278 889 1.0E-166
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 279 948 1.0E-166
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 279 948 2.0E-166
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 274 904 1.0E-165
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 271 886 6.0E-144
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 371 813 2.0E-140
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 266 889 1.0E-133
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 276 890 2.0E-128
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 278 886 3.0E-115
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 271 890 4.0E-115
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 265 798 6.0E-109
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 255 798 2.0E-106
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 238 894 2.0E-104
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 266 894 1.0E-100
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 260 882 4.0E-100
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 266 894 3.0E-97
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 260 882 2.0E-93
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 275 891 6.0E-92
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 266 894 2.0E-88
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 271 891 6.0E-88
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 266 894 1.0E-81
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 266 894 7.0E-79
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 274 891 4.0E-75
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 265 839 6.0E-73
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 273 765 9.0E-73
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 262 726 2.0E-71
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 278 785 3.0E-71
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 253 785 4.0E-71
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 253 785 6.0E-71
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 253 785 1.0E-70
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 278 785 7.0E-70
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 284 825 2.0E-69
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 275 883 2.0E-67
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 227 825 2.0E-67
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 269 883 2.0E-66
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 269 883 2.0E-66
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 269 883 1.0E-65
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 253 796 1.0E-65
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 278 711 1.0E-63
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 263 805 3.0E-63
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 264 794 4.0E-63
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 264 794 1.0E-62
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 264 805 2.0E-62
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 269 883 3.0E-62
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 264 794 9.0E-62
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 278 825 1.0E-61
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 265 764 2.0E-61
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 250 820 2.0E-61
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 277 813 4.0E-61
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 263 805 1.0E-60
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 271 891 2.0E-59
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 264 808 9.0E-59
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 267 891 1.0E-58
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 254 750 8.0E-57
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 278 794 1.0E-56
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 278 794 1.0E-55
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 278 794 2.0E-55
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 234 499 1.0E-53
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 468 891 6.0E-53
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 264 794 8.0E-53
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 514 890 9.0E-53
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 266 508 2.0E-52
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 278 508 2.0E-52
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 279 799 3.0E-52
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 467 891 6.0E-51
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 516 887 8.0E-51
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 483 891 2.0E-49
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 271 508 3.0E-49
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 487 891 3.0E-48
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 222 473 1.0E-47
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 519 889 2.0E-46
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 251 461 3.0E-46
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 467 891 3.0E-46
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 487 890 4.0E-46
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 271 509 7.0E-45
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 275 473 1.0E-43
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 511 899 1.0E-43
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 250 461 2.0E-43
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 267 751 4.0E-43
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 487 891 4.0E-42
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 275 457 9.0E-42
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 275 461 9.0E-42
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 275 461 1.0E-41
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 461 883 2.0E-41
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 470 829 3.0E-41
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 461 883 2.0E-40
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 487 794 2.0E-40
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 459 791 8.0E-40
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 294 695 4.0E-39
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 294 695 2.0E-38
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 267 472 6.0E-38
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 294 695 1.0E-37
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 294 695 2.0E-37
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 294 695 3.0E-37
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 519 898 5.0E-36
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 267 461 9.0E-36
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 487 803 2.0E-35
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 278 644 8.0E-35
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 273 473 5.0E-34
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 228 461 1.0E-33
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 273 461 2.0E-33
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 271 461 7.0E-33
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 260 461 1.0E-31
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 293 644 3.0E-31
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 487 856 4.0E-31
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 630 883 6.0E-14
sp|Q9Q8Q2|NPH2_MYXVL RNA helicase NPH-II OS=Myxoma virus (strain Lausanne) GN=NPH2 PE=3 SV=1 297 645 1.0E-11
sp|Q9Q927|NPH2_RFVKA RNA helicase NPH-II OS=Rabbit fibroma virus (strain Kasza) GN=NPH2 PE=2 SV=1 297 615 2.0E-11
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 274 443 7.0E-10
sp|P21530|POLG_CSFVB Genome polyprotein OS=Classical swine fever virus (strain Brescia) PE=2 SV=1 185 613 9.0E-07
sp|P89201|POLG_SPMMV Genome polyprotein OS=Sweet potato mild mottle virus (isolate Salazar) PE=2 SV=1 288 614 1.0E-06
sp|P19712|POLG_CSFVA Genome polyprotein OS=Classical swine fever virus (strain Alfort) PE=1 SV=2 204 613 2.0E-06
sp|Q89330|POLG_ZYMVR Genome polyprotein OS=Zucchini yellow mosaic virus (strain Reunion Island) PE=3 SV=1 298 635 3.0E-06
sp|P89509|POLG_TUMVJ Genome polyprotein OS=Turnip mosaic virus (strain Japanese) PE=1 SV=1 298 622 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0140657 ATP-dependent activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup12
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7861
Ophiocordyceps australis 1348a (Ghana) OphauG2|6896
Ophiocordyceps australis 1348a (Ghana) OphauG2|6506
Ophiocordyceps australis 1348a (Ghana) OphauG2|3168
Ophiocordyceps australis 1348a (Ghana) OphauG2|20
Ophiocordyceps australis map64 (Brazil) OphauB2|5123
Ophiocordyceps australis map64 (Brazil) OphauB2|2680
Ophiocordyceps australis map64 (Brazil) OphauB2|2813
Ophiocordyceps australis map64 (Brazil) OphauB2|2015
Ophiocordyceps australis map64 (Brazil) OphauB2|2149
Ophiocordyceps camponoti-floridani Ophcf2|01559
Ophiocordyceps camponoti-floridani Ophcf2|06888
Ophiocordyceps camponoti-floridani Ophcf2|06302
Ophiocordyceps camponoti-floridani Ophcf2|00261
Ophiocordyceps camponoti-floridani Ophcf2|05778
Ophiocordyceps camponoti-rufipedis Ophun1|1146
Ophiocordyceps camponoti-rufipedis Ophun1|308
Ophiocordyceps camponoti-rufipedis Ophun1|5443
Ophiocordyceps camponoti-rufipedis Ophun1|6690
Ophiocordyceps camponoti-rufipedis Ophun1|6277 (this protein)
Ophiocordyceps kimflemingae Ophio5|3066
Ophiocordyceps kimflemingae Ophio5|4511
Ophiocordyceps kimflemingae Ophio5|5562
Ophiocordyceps kimflemingae Ophio5|6072
Ophiocordyceps kimflemingae Ophio5|7318
Ophiocordyceps subramaniannii Hirsu2|9346
Ophiocordyceps subramaniannii Hirsu2|8271
Ophiocordyceps subramaniannii Hirsu2|11264
Ophiocordyceps subramaniannii Hirsu2|10215
Ophiocordyceps subramaniannii Hirsu2|10021

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6277
MATDRGFDGYNPKRRKFEDTNFQRRSRHDTRDTSPRARGSTPRRELDQLAPSEQEERALDRDWYGNFEVGGQSLE
DDTYNPLASYEQSWESQQQESAKFDKMTSRYDARQEQRRRENDVWETNRMIISGVAQRRDMGFDFDDGEATRIHL
LVHDLRPPFLDGRTIFTKQLDPIPAVRDYQSDMAVFSRKGSKVVKEARQQRERQKQAQQATSMAGTTLGNIMGAK
EEDGDSALPVVGEEDGHKGERKSKNKFSEHLKGSQGASEFSKKHSLREQREFLPAFAVREELLRVIRENQVTIVV
GETGSGKTTQLTQFLLEDGYGRNGMIGCTQPRRVAAMSVAKRVAEEMEVRLGSTVGYAIRFEDCTSKETIIKYMT
DGVLLRESLNEPDLDRYSCIIMDEAHERALNTDILMGLFKKIIQRRRDLKLIVTSATMNAKRFSDFFGSAPEFTI
PGRTFPVDVMFHRSPVEDYVDQAVQQVLAIHVSMDAGDILVFMTGQEDIEITCELVQKRLDALNDPPKLSILPIY
SQMPADLQAKIFDRAPPGVRKCIVATNIAETSLTVDGIKYVVDAGYSKLKVFNPKMGMDTLQITPISQANSSQRS
GRAGRTGPGKAFRLYTDKAFKEELYPQTIPEIQRTNLSNTVLMLKSLGVKDLLDFDFMDPPPQDTMSTSMFDLWA
LGALDNLGELTELGRKMSAFPMDPSLAKLLITADDEGCSEEMVTIVSMLSVPNVFYRPKERQDEADAKREKFWVH
ESDHLTYLQVYSSWKANGYSDGWCIKHFLHAKSLRRAKEIREQLVDIVRMQKMQLRSCGTDWDVIRRCVCSGYYH
QAARYRGSGEYINLRTNVAVQLHPTSALYGGHPPDYVVYHELVLTSKVYVSTVTAVDPHWLADLGGVFYSVREKG
YSAREKRTTETEFNRRMEIEAQMADDKRRQDERLRADDERARARARARDDGAGGGKRHHPPILPPNLDNLSPPRP
LRNIPQEELQRVILALSLALNLHAPHQP*
Coding >Ophun1|6277
ATGGCGACCGACAGAGGCTTCGACGGATACAACCCGAAGAGAAGGAAGTTTGAAGACACGAATTTCCAGAGACGC
AGCCGCCATGATACGCGGGATACCTCGCCCCGAGCGCGTGGCTCGACACCCCGACGGGAGCTCGATCAGCTGGCG
CCCAGCGAGCAGGAAGAACGCGCTTTAGACAGAGACTGGTACGGAAACTTTGAGGTCGGTGGACAGTCACTCGAA
GATGACACGTATAATCCTCTCGCCTCGTACGAGCAGTCCTGGGAAAGTCAGCAGCAGGAGTCGGCCAAGTTCGAC
AAGATGACGAGCCGGTACGATGCTAGACAGGAGCAGCGGCGCAGAGAAAACGACGTCTGGGAGACCAACAGGATG
ATTATATCGGGGGTCGCGCAGAGGAGGGACATGGGCTTTGACTTTGACGACGGCGAGGCGACGCGCATCCATCTC
TTGGTTCACGACCTCCGTCCCCCCTTTCTCGACGGCCGCACCATCTTTACCAAGCAGCTCGACCCAATTCCCGCT
GTTCGCGACTACCAGAGCGACATGGCCGTCTTCAGCAGGAAAGGCAGCAAGGTGGTCAAGGAAGCGCGCCAGCAG
AGGGAGCGGCAGAAACAGGCGCAGCAGGCGACGAGCATGGCGGGAACGACGCTGGGCAACATCATGGGTGCCAAA
GAAGAGGACGGCGATAGCGCCCTTCCGGTCGTCGGCGAGGAAGACGGGCACAAGGGCGAGCGCAAGAGCAAGAAC
AAGTTCAGCGAGCACCTCAAGGGCAGCCAAGGAGCCAGTGAATTCAGCAAGAAACACTCGCTGCGGGAACAGCGA
GAATTCCTGCCGGCGTTTGCCGTCCGCGAAGAGCTGCTGCGTGTCATCCGGGAGAATCAGGTGACCATCGTGGTG
GGCGAGACGGGCTCTGGCAAGACGACGCAGTTGACGCAGTTTCTCCTCGAGGACGGCTACGGCCGCAACGGCATG
ATTGGATGCACGCAGCCGCGTCGTGTCGCGGCCATGAGCGTGGCCAAGCGCGTGGCTGAAGAGATGGAGGTCAGA
CTGGGCAGCACCGTCGGTTACGCCATCCGGTTCGAGGACTGCACGAGCAAGGAGACCATCATCAAGTACATGACG
GACGGCGTGCTGCTGCGGGAGTCGCTCAACGAGCCCGACCTCGACCGGTACTCGTGCATCATCATGGACGAAGCA
CACGAACGGGCCCTCAACACGGACATCTTGATGGGGCTGTTCAAGAAGATTATCCAGAGGCGACGGGACCTGAAG
CTCATCGTCACGTCGGCGACGATGAACGCCAAGCGCTTCTCCGACTTCTTCGGCTCGGCGCCCGAGTTTACGATC
CCGGGCCGGACGTTTCCGGTAGACGTCATGTTCCACCGCTCGCCGGTCGAGGACTACGTCGACCAGGCGGTACAG
CAAGTGCTGGCCATTCACGTGTCCATGGACGCCGGCGATATCCTCGTCTTCATGACGGGCCAGGAGGACATTGAA
ATCACGTGCGAGCTGGTACAGAAGCGGCTCGACGCCCTCAACGACCCGCCCAAGCTGAGCATCCTGCCCATCTAC
AGCCAGATGCCGGCCGATCTCCAGGCCAAGATCTTCGACCGCGCGCCTCCAGGGGTTCGCAAGTGCATCGTGGCC
ACCAACATCGCCGAGACGAGCTTGACGGTCGACGGCATCAAGTACGTCGTCGACGCCGGCTACTCCAAGCTCAAG
GTCTTCAACCCCAAGATGGGCATGGACACTCTCCAGATCACGCCCATCTCGCAGGCCAACAGCTCGCAGCGTTCG
GGCCGGGCCGGACGGACGGGGCCGGGCAAGGCCTTCCGACTCTACACGGACAAGGCCTTCAAGGAGGAGCTATAC
CCGCAGACTATACCGGAGATCCAGCGGACGAACCTCTCAAACACGGTGCTGATGCTCAAGTCGTTAGGGGTCAAA
GACCTACTAGACTTTGACTTTATGGACCCGCCTCCTCAGGACACCATGTCGACGTCCATGTTCGACCTGTGGGCG
TTGGGCGCTCTGGATAACCTCGGGGAGCTGACGGAGCTGGGACGCAAGATGAGCGCGTTCCCGATGGACCCGTCG
CTAGCCAAGCTCCTCATCACGGCCGACGACGAGGGCTGCAGCGAGGAGATGGTGACGATTGTGTCGATGCTCTCG
GTCCCCAACGTCTTCTACCGACCCAAGGAGCGACAAGACGAGGCCGACGCCAAGCGCGAGAAGTTCTGGGTGCAC
GAGTCGGATCACCTGACGTACCTACAGGTGTATTCCTCGTGGAAGGCCAACGGCTACTCGGACGGATGGTGCATC
AAGCACTTCCTGCACGCCAAGTCGCTGCGGCGGGCCAAGGAGATACGCGAGCAGCTGGTGGACATTGTCCGGATG
CAGAAGATGCAGCTCCGCAGCTGCGGAACCGACTGGGACGTGATCCGTCGCTGCGTCTGCTCGGGCTACTATCAC
CAGGCAGCACGATACCGCGGCTCAGGCGAATACATCAACCTGCGGACCAACGTGGCCGTCCAGCTCCATCCAACC
AGCGCCCTCTACGGCGGCCACCCGCCCGACTACGTCGTCTACCACGAGCTGGTGCTGACGTCCAAGGTGTACGTG
TCGACGGTGACGGCGGTGGATCCCCACTGGCTGGCCGACCTCGGCGGCGTCTTCTACTCGGTGCGCGAGAAGGGC
TACTCTGCGCGCGAGAAGCGGACGACGGAGACGGAGTTTAACCGGCGGATGGAGATTGAGGCTCAGATGGCGGAC
GATAAGCGCAGGCAGGATGAGAGGCTGCGGGCTGACGATGAGAGGGCGAGGGCGAGGGCGAGGGCGAGGGATGAT
GGGGCGGGGGGGGGGAAGAGACACCACCCCCCGATCCTCCCTCCCAACCTCGACAACCTCAGCCCCCCTCGGCCC
CTGCGCAACATCCCCCAGGAAGAGCTCCAACGCGTCATCCTCGCCCTGAGCCTCGCCCTCAACCTACACGCGCCC
CATCAGCCATGA
Transcript >Ophun1|6277
ATGGCGACCGACAGAGGCTTCGACGGATACAACCCGAAGAGAAGGAAGTTTGAAGACACGAATTTCCAGAGACGC
AGCCGCCATGATACGCGGGATACCTCGCCCCGAGCGCGTGGCTCGACACCCCGACGGGAGCTCGATCAGCTGGCG
CCCAGCGAGCAGGAAGAACGCGCTTTAGACAGAGACTGGTACGGAAACTTTGAGGTCGGTGGACAGTCACTCGAA
GATGACACGTATAATCCTCTCGCCTCGTACGAGCAGTCCTGGGAAAGTCAGCAGCAGGAGTCGGCCAAGTTCGAC
AAGATGACGAGCCGGTACGATGCTAGACAGGAGCAGCGGCGCAGAGAAAACGACGTCTGGGAGACCAACAGGATG
ATTATATCGGGGGTCGCGCAGAGGAGGGACATGGGCTTTGACTTTGACGACGGCGAGGCGACGCGCATCCATCTC
TTGGTTCACGACCTCCGTCCCCCCTTTCTCGACGGCCGCACCATCTTTACCAAGCAGCTCGACCCAATTCCCGCT
GTTCGCGACTACCAGAGCGACATGGCCGTCTTCAGCAGGAAAGGCAGCAAGGTGGTCAAGGAAGCGCGCCAGCAG
AGGGAGCGGCAGAAACAGGCGCAGCAGGCGACGAGCATGGCGGGAACGACGCTGGGCAACATCATGGGTGCCAAA
GAAGAGGACGGCGATAGCGCCCTTCCGGTCGTCGGCGAGGAAGACGGGCACAAGGGCGAGCGCAAGAGCAAGAAC
AAGTTCAGCGAGCACCTCAAGGGCAGCCAAGGAGCCAGTGAATTCAGCAAGAAACACTCGCTGCGGGAACAGCGA
GAATTCCTGCCGGCGTTTGCCGTCCGCGAAGAGCTGCTGCGTGTCATCCGGGAGAATCAGGTGACCATCGTGGTG
GGCGAGACGGGCTCTGGCAAGACGACGCAGTTGACGCAGTTTCTCCTCGAGGACGGCTACGGCCGCAACGGCATG
ATTGGATGCACGCAGCCGCGTCGTGTCGCGGCCATGAGCGTGGCCAAGCGCGTGGCTGAAGAGATGGAGGTCAGA
CTGGGCAGCACCGTCGGTTACGCCATCCGGTTCGAGGACTGCACGAGCAAGGAGACCATCATCAAGTACATGACG
GACGGCGTGCTGCTGCGGGAGTCGCTCAACGAGCCCGACCTCGACCGGTACTCGTGCATCATCATGGACGAAGCA
CACGAACGGGCCCTCAACACGGACATCTTGATGGGGCTGTTCAAGAAGATTATCCAGAGGCGACGGGACCTGAAG
CTCATCGTCACGTCGGCGACGATGAACGCCAAGCGCTTCTCCGACTTCTTCGGCTCGGCGCCCGAGTTTACGATC
CCGGGCCGGACGTTTCCGGTAGACGTCATGTTCCACCGCTCGCCGGTCGAGGACTACGTCGACCAGGCGGTACAG
CAAGTGCTGGCCATTCACGTGTCCATGGACGCCGGCGATATCCTCGTCTTCATGACGGGCCAGGAGGACATTGAA
ATCACGTGCGAGCTGGTACAGAAGCGGCTCGACGCCCTCAACGACCCGCCCAAGCTGAGCATCCTGCCCATCTAC
AGCCAGATGCCGGCCGATCTCCAGGCCAAGATCTTCGACCGCGCGCCTCCAGGGGTTCGCAAGTGCATCGTGGCC
ACCAACATCGCCGAGACGAGCTTGACGGTCGACGGCATCAAGTACGTCGTCGACGCCGGCTACTCCAAGCTCAAG
GTCTTCAACCCCAAGATGGGCATGGACACTCTCCAGATCACGCCCATCTCGCAGGCCAACAGCTCGCAGCGTTCG
GGCCGGGCCGGACGGACGGGGCCGGGCAAGGCCTTCCGACTCTACACGGACAAGGCCTTCAAGGAGGAGCTATAC
CCGCAGACTATACCGGAGATCCAGCGGACGAACCTCTCAAACACGGTGCTGATGCTCAAGTCGTTAGGGGTCAAA
GACCTACTAGACTTTGACTTTATGGACCCGCCTCCTCAGGACACCATGTCGACGTCCATGTTCGACCTGTGGGCG
TTGGGCGCTCTGGATAACCTCGGGGAGCTGACGGAGCTGGGACGCAAGATGAGCGCGTTCCCGATGGACCCGTCG
CTAGCCAAGCTCCTCATCACGGCCGACGACGAGGGCTGCAGCGAGGAGATGGTGACGATTGTGTCGATGCTCTCG
GTCCCCAACGTCTTCTACCGACCCAAGGAGCGACAAGACGAGGCCGACGCCAAGCGCGAGAAGTTCTGGGTGCAC
GAGTCGGATCACCTGACGTACCTACAGGTGTATTCCTCGTGGAAGGCCAACGGCTACTCGGACGGATGGTGCATC
AAGCACTTCCTGCACGCCAAGTCGCTGCGGCGGGCCAAGGAGATACGCGAGCAGCTGGTGGACATTGTCCGGATG
CAGAAGATGCAGCTCCGCAGCTGCGGAACCGACTGGGACGTGATCCGTCGCTGCGTCTGCTCGGGCTACTATCAC
CAGGCAGCACGATACCGCGGCTCAGGCGAATACATCAACCTGCGGACCAACGTGGCCGTCCAGCTCCATCCAACC
AGCGCCCTCTACGGCGGCCACCCGCCCGACTACGTCGTCTACCACGAGCTGGTGCTGACGTCCAAGGTGTACGTG
TCGACGGTGACGGCGGTGGATCCCCACTGGCTGGCCGACCTCGGCGGCGTCTTCTACTCGGTGCGCGAGAAGGGC
TACTCTGCGCGCGAGAAGCGGACGACGGAGACGGAGTTTAACCGGCGGATGGAGATTGAGGCTCAGATGGCGGAC
GATAAGCGCAGGCAGGATGAGAGGCTGCGGGCTGACGATGAGAGGGCGAGGGCGAGGGCGAGGGCGAGGGATGAT
GGGGCGGGGGGGGGGAAGAGACACCACCCCCCGATCCTCCCTCCCAACCTCGACAACCTCAGCCCCCCTCGGCCC
CTGCGCAACATCCCCCAGGAAGAGCTCCAACGCGTCATCCTCGCCCTGAGCCTCGCCCTCAACCTACACGCGCCC
CATCAGCCATGA
Gene >Ophun1|6277
ATGGCGACCGACAGAGGCTTCGACGGATACAACCCGAAGAGAAGGAAGTTTGAAGACACGAATTTCCAGAGACGC
AGCCGCCATGATACGCGGGATACCTCGCCCCGAGCGCGTGGCTCGACACCCCGACGGGAGCTCGATCAGCTGGCG
CCCAGCGAGCAGGAAGAACGCGCTTTAGACAGAGACTGGTACGGAAACTTTGAGGTCGGTGGACAGTCACTCGAA
GATGACACGTATAATCCTCTCGCCTCGTACGAGCAGTCCTGGGAAAGTCAGCAGCAGGAGTCGGCCAAGTTCGAC
AAGATGACGAGCCGGTACGATGCTAGACAGGAGCAGCGGCGCAGAGAAAACGACGTCTGGGAGACCAACAGGATG
ATTATATCGGGGGTCGCGCAGAGGAGGGACATGGGCTTTGACTTTGACGACGGCGAGGCGACGCGCATCCATCTC
TTGGTTCACGACCTCCGTCCCCCCTTTCTCGACGGCCGCACCATCTTTACCAAGCAGCTCGACCCAATTCCCGCT
GTTCGCGACTACCAGAGCGACATGGCCGTCTTCAGCAGGAAAGGCAGCAAGGTGGTCAAGGAAGCGCGCCAGCAG
AGGGAGCGGCAGAAACAGGCGCAGCAGGCGACGAGCATGGCGGGAACGACGCTGGGCAACATCATGGGTGCCAAA
GAAGAGGACGGCGATAGCGCCCTTCCGGTCGTCGGCGAGGAAGACGGGCACAAGGGCGAGCGCAAGAGCAAGAAC
AAGTTCAGCGAGCACCTCAAGGGCAGCCAAGGAGCCAGTGAATTCAGCAAGAAACACTCGCTGCGGGAACAGCGA
GAATTCCTGCCGGCGTTTGCCGTCCGCGAAGAGCTGCTGCGTGTCATCCGGGAGAATCAGGTGACCATCGTGGTG
GGCGAGACGGGCTCTGGCAAGACGACGCAGTTGACGCAGTTTCTCCTCGAGGACGGCTACGGCCGCAACGGCATG
ATTGGATGCACGCAGCCGCGTCGTGTCGCGGCCATGAGCGTGGCCAAGCGCGTGGCTGAAGAGATGGAGGTCAGA
CTGGGCAGCACCGTCGGTTACGCCATCCGGTTCGAGGACTGCACGAGCAAGGAGACCATCATCAAGTACATGACG
GACGGCGTGCTGCTGCGGGAGTCGCTCAACGAGCCCGACCTCGACCGGTACTCGTGCATCATCATGGACGAAGCA
CACGAACGGGCCCTCAACACGGACATCTTGATGGGGCTGTTCAAGAAGATTATCCAGAGGCGACGGGACCTGAAG
CTCATCGTCACGTCGGCGACGATGAACGCCAAGCGCTTCTCCGACTTCTTCGGCTCGGCGCCCGAGTTTACGATC
CCGGGCCGGACGTTTCCGGTAGACGTCATGTTCCACCGCTCGCCGGTCGAGGACTACGTCGACCAGGCGGTACAG
CAAGTGCTGGCCATTCACGTGTCCATGGACGCCGGCGATATCCTCGTCTTCATGACGGGCCAGGAGGACATTGAA
ATCACGTGCGAGCTGGTACAGAAGCGGCTCGACGCCCTCAACGACCCGCCCAAGCTGAGCATCCTGCCCATCTAC
AGCCAGATGCCGGCCGATCTCCAGGCCAAGATCTTCGACCGCGCGCCTCCAGGGGTTCGCAAGTGCATCGTGGCC
ACCAACATCGCCGAGACGAGCTTGACGGTCGACGGCATCAAGTACGTCGTCGACGCCGGCTACTCCAAGCTCAAG
GTCTTCAACCCCAAGATGGGCATGGACACTCTCCAGATCACGCCCATCTCGCAGGCCAACAGCTCGCAGCGTTCG
GGCCGGGCCGGACGGACGGGGCCGGGCAAGGCCTTCCGACTCTACACGGACAAGGCCTTCAAGGAGGAGCTATAC
CCGCAGACTATACCGGAGATCCAGCGGACGAACCTCTCAAACACGGTGCTGATGCTCAAGTCGTTAGGGGTCAAA
GACCTACTAGACTTTGACTTTATGGACCCGCCTCCTCAGGACACCATGTCGACGTCCATGTTCGACCTGTGGGCG
TTGGGCGCTCTGGATAACCTCGGGGAGCTGACGGAGCTGGGACGCAAGATGAGCGCGTTCCCGATGGACCCGTCG
CTAGCCAAGCTCCTCATCACGGCCGACGACGAGGGCTGCAGCGAGGAGATGGTGACGATTGTGTCGATGCTCTCG
GTCCCCAACGTCTTCTACCGACCCAAGGAGCGACAAGACGAGGCCGACGCCAAGCGCGAGAAGTTCTGGGTGCAC
GAGTCGGATCACCTGACGTACCTACAGGTGTATTCCTCGTGGAAGGCCAACGGCTACTCGGACGGATGGTGCATC
AAGCACTTCCTGCACGCCAAGTCGCTGCGGCGGGCCAAGGAGATACGCGAGCAGCTGGTGGACATTGTCCGGATG
CAGAAGATGCAGCTCCGCAGCTGCGGAACCGACTGGGACGTGATCCGTCGCTGCGTCTGCTCGGGCTACTATCAC
CAGGCAGCACGATACCGCGGCTCAGGCGAATACATCAACCTGCGGACCAACGTGGCCGTCCAGCTCCATCCAACC
AGCGCCCTCTACGGCGGCCACCCGCCCGACTACGTCGTCTACCACGAGCTGGTGCTGACGTCCAAGGTGTACGTG
TCGACGGTGACGGCGGTGGATCCCCACTGGCTGGCCGACCTCGGCGGCGTCTTCTACTCGGTGCGCGAGAAGGGC
TACTCTGCGCGCGAGAAGCGGACGACGGAGACGGAGTTTAACCGGCGGATGGAGATTGAGGCTCAGATGGCGGAC
GATAAGCGCAGGCAGGATGAGAGGCTGCGGGCTGACGATGAGAGGGCGAGGGCGAGGGCGAGGGCGAGGGATGAT
GGGGCGGGGGGGGGGAAGAGGTTTGTGACGCAGGGGGCTGTTAGGAAGCCGGTTGTCAAGAGGCGAGGAAGGGGG
TTCTGAGGGTTGTATTCTGCCTGATTGTATCCGTATATAGATATGGCACGGCTTCAAGTACGGATAGCAAAGCCC
GACTCCCCAGACACCACCCCCCGATCCTCCCTCCCAACCTCGACAACCTCAGCCCCCCTCGGCCCCTGCGCAACA
TCCCCCAGGAAGAGCTCCAACGCGTCATCCTCGCCCTGAGCCTCGCCCTCAACCTACACGCGCCCCATCAGCCAT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail