Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6276
Gene name
LocationContig_676:178..1000
Strand-
Gene length (bp)822
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07052 Hep_59 Hepatocellular carcinoma-associated antigen 59 9.5E-10 93 183

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6355
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7860
Ophiocordyceps australis map64 (Brazil) OphauB2|2151
Ophiocordyceps camponoti-floridani Ophcf2|00259
Ophiocordyceps camponoti-rufipedis Ophun1|6276 (this protein)
Ophiocordyceps kimflemingae Ophio5|6074

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6276
MTPLPTPPLFRRPNPNPHHHQTPRRQRSPSPESSDSNARPVVIRPRVHKRPCGIVASSTDANSLAGVSAAAAAAT
SSSAPLQETDPVRGIAHRFTRQTGVVADLQDKHMTEYIESRLASRMEANRRPRKSDTASSSISAPDEDEPNNNNN
DNQAPESHPPKQPDQPTKHGKLFEVAIPQDVRQGRHHSSSRNRDPKSKPQAHPNPRNRRGSDDLKRDDFVDQFLQ
ENKLPFPSSSSPPPPFHLVNPIINQ*
Coding >Ophun1|6276
ATGACACCCCTTCCCACCCCCCCCCTCTTCCGCCGCCCGAATCCAAACCCGCACCACCACCAAACCCCCCGTCGC
CAACGCTCCCCCTCCCCCGAATCATCCGACAGCAACGCCCGCCCCGTCGTCATCCGTCCCCGCGTCCACAAGCGC
CCCTGCGGAATCGTCGCCTCCTCCACGGATGCAAATTCCCTCGCTGGTGTCTCCGCCGCCGCTGCTGCTGCTACC
TCGTCGTCCGCGCCGCTGCAGGAGACCGATCCCGTCAGGGGCATCGCTCACCGCTTCACCAGACAGACTGGTGTC
GTCGCTGACCTGCAGGATAAACACATGACGGAATACATAGAATCCCGCCTCGCAAGCCGCATGGAAGCCAACCGC
CGCCCCCGGAAATCAGACACCGCCTCATCATCAATCTCAGCCCCAGATGAAGACGAGCCCAACAACAACAACAAC
GATAATCAAGCTCCAGAATCTCACCCCCCTAAACAACCAGACCAGCCCACCAAACACGGCAAACTCTTCGAAGTC
GCGATCCCCCAAGACGTCCGTCAAGGCCGTCACCATTCCTCCTCCCGCAACCGCGACCCCAAATCTAAACCCCAG
GCCCATCCCAACCCTCGCAACCGCCGCGGCAGCGATGACTTGAAGAGAGATGACTTTGTCGACCAATTCCTCCAA
GAAAACAAACTTCCGTTTCCATCCTCCTCCTCCCCTCCCCCCCCTTTCCATCTAGTTAACCCCATCATCAACCAG
TAA
Transcript >Ophun1|6276
ATGACACCCCTTCCCACCCCCCCCCTCTTCCGCCGCCCGAATCCAAACCCGCACCACCACCAAACCCCCCGTCGC
CAACGCTCCCCCTCCCCCGAATCATCCGACAGCAACGCCCGCCCCGTCGTCATCCGTCCCCGCGTCCACAAGCGC
CCCTGCGGAATCGTCGCCTCCTCCACGGATGCAAATTCCCTCGCTGGTGTCTCCGCCGCCGCTGCTGCTGCTACC
TCGTCGTCCGCGCCGCTGCAGGAGACCGATCCCGTCAGGGGCATCGCTCACCGCTTCACCAGACAGACTGGTGTC
GTCGCTGACCTGCAGGATAAACACATGACGGAATACATAGAATCCCGCCTCGCAAGCCGCATGGAAGCCAACCGC
CGCCCCCGGAAATCAGACACCGCCTCATCATCAATCTCAGCCCCAGATGAAGACGAGCCCAACAACAACAACAAC
GATAATCAAGCTCCAGAATCTCACCCCCCTAAACAACCAGACCAGCCCACCAAACACGGCAAACTCTTCGAAGTC
GCGATCCCCCAAGACGTCCGTCAAGGCCGTCACCATTCCTCCTCCCGCAACCGCGACCCCAAATCTAAACCCCAG
GCCCATCCCAACCCTCGCAACCGCCGCGGCAGCGATGACTTGAAGAGAGATGACTTTGTCGACCAATTCCTCCAA
GAAAACAAACTTCCGTTTCCATCCTCCTCCTCCCCTCCCCCCCCTTTCCATCTAGTTAACCCCATCATCAACCAG
TAA
Gene >Ophun1|6276
ATGACACCCCTTCCCACCCCCCCCCTCTTCCGCCGCCCGAATCCAAACCCGCACCACCACCAAACCCCCCGTCGC
CAACGCTCCCCCTCCCCCGAATCATCCGACAGCAACGCCCGCCCCGTCGTCATCCGTCCCCGCGTCCACAAGCGC
CCCTGCGGAATCGTCGCCTCCTCCACGGATGCAAATTCCCTCGCTGGTGTCTCCGCCGCCGCTGCTGCTGCTACC
TCGTCGTCCGCGCCGCTGCAGGAGACCGATCCCGTCAGGGGCATCGCTCACCGCTTCACCAGACAGACTGGTGTC
GTCGCTGACCTGCAGGATAAACACATGTTCGTTTCTCCTCCTCTTTTCCCCCCTCCCCCCCCCCGGAAAAACAAT
CTGAAAGCTAAGCATTCAAGGACGGAATACATAGAATCCCGCCTCGCAAGCCGCATGGAAGCCAACCGCCGCCCC
CGGAAATCAGACACCGCCTCATCATCAATCTCAGCCCCAGATGAAGACGAGCCCAACAACAACAACAACGATAAT
CAAGCTCCAGAATCTCACCCCCCTAAACAACCAGACCAGCCCACCAAACACGGCAAACTCTTCGAAGTCGCGATC
CCCCAAGACGTCCGTCAAGGCCGTCACCATTCCTCCTCCCGCAACCGCGACCCCAAATCTAAACCCCAGGCCCAT
CCCAACCCTCGCAACCGCCGCGGCAGCGATGACTTGAAGAGAGATGACTTTGTCGACCAATTCCTCCAAGAAAAC
AAACTTCCGTTTCCATCCTCCTCCTCCCCTCCCCCCCCTTTCCATCTAGTTAACCCCATCATCAACCAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail