Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6275
Gene name
LocationContig_675:187..9716
Strand-
Gene length (bp)9529
Transcript length (bp)9474
Coding sequence length (bp)9474
Protein length (aa) 3158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12774 AAA_6 Hydrolytic ATP binding site of dynein motor region 3.7E-126 1092 1431
PF08393 DHC_N2 Dynein heavy chain, N-terminal region 2 3.8E-120 548 950
PF12781 AAA_9 ATP-binding dynein motor region 3.5E-77 2758 2976
PF12780 AAA_8 P-loop containing dynein motor region D4 1.8E-64 2103 2381
PF12775 AAA_7 P-loop containing dynein motor region 1.7E-35 1757 1931
PF12777 MT Microtubule-binding stalk of dynein motor 3.5E-37 2396 2727
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.7E-12 1419 1553
PF07728 AAA_5 AAA domain (dynein-related subfamily) 6.3E-05 2127 2283
PF17852 Dynein_AAA_lid Dynein heavy chain AAA lid domain 3.0E-13 1622 1744

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA4 PE=3 SV=1 444 3084 0.0E+00
sp|P39057|DYHC_HELCR Dynein beta chain, ciliary OS=Heliocidaris crassispina PE=1 SV=1 519 3084 0.0E+00
sp|Q9C0G6|DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=2 SV=3 514 3084 0.0E+00
sp|Q8TE73|DYH5_HUMAN Dynein heavy chain 5, axonemal OS=Homo sapiens GN=DNAH5 PE=1 SV=3 500 3074 0.0E+00
sp|Q8VHE6|DYH5_MOUSE Dynein heavy chain 5, axonemal OS=Mus musculus GN=Dnah5 PE=1 SV=2 500 3074 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA4 PE=3 SV=1 444 3084 0.0E+00
sp|P39057|DYHC_HELCR Dynein beta chain, ciliary OS=Heliocidaris crassispina PE=1 SV=1 519 3084 0.0E+00
sp|Q9C0G6|DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=2 SV=3 514 3084 0.0E+00
sp|Q8TE73|DYH5_HUMAN Dynein heavy chain 5, axonemal OS=Homo sapiens GN=DNAH5 PE=1 SV=3 500 3074 0.0E+00
sp|Q8VHE6|DYH5_MOUSE Dynein heavy chain 5, axonemal OS=Mus musculus GN=Dnah5 PE=1 SV=2 500 3074 0.0E+00
sp|Q96DT5|DYH11_HUMAN Dynein heavy chain 11, axonemal OS=Homo sapiens GN=DNAH11 PE=1 SV=4 440 3154 0.0E+00
sp|Q69Z23|DYH17_MOUSE Dynein heavy chain 17, axonemal OS=Mus musculus GN=Dnah17 PE=1 SV=2 548 3101 0.0E+00
sp|Q9NYC9|DYH9_HUMAN Dynein heavy chain 9, axonemal OS=Homo sapiens GN=DNAH9 PE=1 SV=3 553 3101 0.0E+00
sp|Q9UFH2|DYH17_HUMAN Dynein heavy chain 17, axonemal OS=Homo sapiens GN=DNAH17 PE=1 SV=2 533 3101 0.0E+00
sp|Q91XQ0|DYH8_MOUSE Dynein heavy chain 8, axonemal OS=Mus musculus GN=Dnah8 PE=1 SV=2 473 3084 0.0E+00
sp|Q63170|DYH7_RAT Dynein heavy chain 7, axonemal OS=Rattus norvegicus GN=Dnah7 PE=2 SV=2 575 3084 0.0E+00
sp|Q8WXX0|DYH7_HUMAN Dynein heavy chain 7, axonemal OS=Homo sapiens GN=DNAH7 PE=1 SV=2 636 3084 0.0E+00
sp|P45443|DYHC_NEUCR Dynein heavy chain, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-1 PE=3 SV=1 1 3155 0.0E+00
sp|Q39575|DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA2 PE=1 SV=1 269 3084 0.0E+00
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 508 3032 0.0E+00
sp|Q8BW94|DYH3_MOUSE Dynein heavy chain 3, axonemal OS=Mus musculus GN=Dnah3 PE=1 SV=2 595 3139 0.0E+00
sp|Q8TD57|DYH3_HUMAN Dynein heavy chain 3, axonemal OS=Homo sapiens GN=DNAH3 PE=2 SV=1 595 3145 0.0E+00
sp|Q9P2D7|DYH1_HUMAN Dynein heavy chain 1, axonemal OS=Homo sapiens GN=DNAH1 PE=2 SV=4 538 2638 0.0E+00
sp|Q6ZR08|DYH12_HUMAN Dynein heavy chain 12, axonemal OS=Homo sapiens GN=DNAH12 PE=2 SV=2 637 2175 0.0E+00
sp|Q923J6|DYH12_RAT Dynein heavy chain 12, axonemal OS=Rattus norvegicus GN=Dnah12 PE=2 SV=2 637 2172 0.0E+00
sp|Q3V0Q1|DYH12_MOUSE Dynein heavy chain 12, axonemal OS=Mus musculus GN=Dnah12 PE=1 SV=2 637 2175 0.0E+00
sp|Q9SMH5|DYHC2_CHLRE Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii GN=DHC1B PE=1 SV=2 445 1580 0.0E+00
sp|Q19542|DYHC2_CAEEL Cytoplasmic dynein 2 heavy chain 1 OS=Caenorhabditis elegans GN=che-3 PE=3 SV=2 444 1579 0.0E+00
sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens GN=DYNC2H1 PE=1 SV=4 445 1579 0.0E+00
sp|Q9P225|DYH2_HUMAN Dynein heavy chain 2, axonemal OS=Homo sapiens GN=DNAH2 PE=2 SV=3 284 3048 0.0E+00
sp|P78716|DYHC_FUSSO Dynein heavy chain, cytoplasmic OS=Fusarium solani subsp. pisi GN=DHC1 PE=3 SV=1 1 3156 0.0E+00
sp|P45444|DYHC_EMENI Dynein heavy chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudA PE=3 SV=2 1 3155 0.0E+00
sp|Q14204|DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens GN=DYNC1H1 PE=1 SV=5 5 3143 0.0E+00
sp|Q9JHU4|DYHC1_MOUSE Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus GN=Dync1h1 PE=1 SV=2 5 3143 0.0E+00
sp|P37276|DYHC_DROME Dynein heavy chain, cytoplasmic OS=Drosophila melanogaster GN=Dhc64C PE=2 SV=2 7 3139 0.0E+00
sp|P38650|DYHC1_RAT Cytoplasmic dynein 1 heavy chain 1 OS=Rattus norvegicus GN=Dync1h1 PE=1 SV=1 5 3143 0.0E+00
sp|P34036|DYHC_DICDI Dynein heavy chain, cytoplasmic OS=Dictyostelium discoideum GN=dhcA PE=1 SV=2 3 3084 0.0E+00
sp|Q19020|DYHC_CAEEL Dynein heavy chain, cytoplasmic OS=Caenorhabditis elegans GN=dhc-1 PE=1 SV=1 75 3083 0.0E+00
sp|Q27171|DYHC_PARTE Dynein heavy chain, cytoplasmic OS=Paramecium tetraurelia GN=DHC-8 PE=2 SV=1 71 3086 0.0E+00
sp|Q9C1M7|DYHC_ASHGO Dynein heavy chain, cytoplasmic OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DYN1 PE=3 SV=1 109 3083 0.0E+00
sp|P36022|DYHC_YEAST Dynein heavy chain, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DYN1 PE=1 SV=1 256 3036 0.0E+00
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein MAL7P1.162 OS=Plasmodium falciparum (isolate 3D7) GN=MAL7P1.162 PE=2 SV=2 1604 3084 0.0E+00
sp|P23098|DYHC_TRIGR Dynein beta chain, ciliary OS=Tripneustes gratilla PE=1 SV=1 519 3084 0.0E+00
sp|Q45VK7|DYHC2_MOUSE Cytoplasmic dynein 2 heavy chain 1 OS=Mus musculus GN=Dync2h1 PE=1 SV=1 198 3081 0.0E+00
sp|P0C6F1|DYH2_MOUSE Dynein heavy chain 2, axonemal OS=Mus musculus GN=Dnah2 PE=1 SV=1 284 3034 0.0E+00
sp|Q9JJ79|DYHC2_RAT Cytoplasmic dynein 2 heavy chain 1 OS=Rattus norvegicus GN=Dync2h1 PE=1 SV=1 198 3081 0.0E+00
sp|Q8IVF4|DYH10_HUMAN Dynein heavy chain 10, axonemal OS=Homo sapiens GN=DNAH10 PE=1 SV=4 254 3036 0.0E+00
sp|Q9SMH3|DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii GN=DHC1 PE=1 SV=1 504 3104 0.0E+00
sp|Q9MBF8|DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii GN=DHC10 PE=1 SV=1 281 3145 0.0E+00
sp|Q27802|DYHC2_TRIGR Cytoplasmic dynein 2 heavy chain 1 OS=Tripneustes gratilla GN=DYH1B PE=2 SV=2 191 3086 0.0E+00
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein MAL7P1.162 OS=Plasmodium falciparum (isolate 3D7) GN=MAL7P1.162 PE=2 SV=2 273 1582 0.0E+00
sp|O13290|DYHC_SCHPO Dynein heavy chain, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dhc1 PE=1 SV=1 3 3077 0.0E+00
sp|Q9SMH5|DYHC2_CHLRE Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii GN=DHC1B PE=1 SV=2 1775 3085 6.0E-179
sp|Q96JB1|DYH8_HUMAN Dynein heavy chain 8, axonemal OS=Homo sapiens GN=DNAH8 PE=1 SV=2 473 1570 5.0E-168
sp|Q63164|DYH1_RAT Dynein heavy chain 1, axonemal OS=Rattus norvegicus GN=Dnah1 PE=2 SV=2 540 1589 3.0E-163
sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens GN=DYNC2H1 PE=1 SV=4 1763 3081 6.0E-158
sp|Q63164|DYH1_RAT Dynein heavy chain 1, axonemal OS=Rattus norvegicus GN=Dnah1 PE=2 SV=2 1740 3084 4.0E-154
sp|Q96JB1|DYH8_HUMAN Dynein heavy chain 8, axonemal OS=Homo sapiens GN=DNAH8 PE=1 SV=2 1723 3084 2.0E-141
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 1081 2308 7.0E-131
sp|Q19542|DYHC2_CAEEL Cytoplasmic dynein 2 heavy chain 1 OS=Caenorhabditis elegans GN=che-3 PE=3 SV=2 1764 3087 2.0E-115
sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3 1041 1943 5.0E-93
sp|Q9P2D7|DYH1_HUMAN Dynein heavy chain 1, axonemal OS=Homo sapiens GN=DNAH1 PE=2 SV=4 2672 3084 2.0E-58
sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3 2131 2614 7.0E-42
sp|Q96M86|DNHD1_HUMAN Dynein heavy chain domain-containing protein 1 OS=Homo sapiens GN=DNHD1 PE=2 SV=2 559 1797 3.0E-40
sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3 2758 3028 4.0E-27
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 2763 3032 8.0E-27
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 2365 2725 3.0E-24
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 619 902 8.0E-23
sp|Q96M86|DNHD1_HUMAN Dynein heavy chain domain-containing protein 1 OS=Homo sapiens GN=DNHD1 PE=2 SV=2 2108 2728 6.0E-22
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein MAL7P1.162 OS=Plasmodium falciparum (isolate 3D7) GN=MAL7P1.162 PE=2 SV=2 71 249 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6275
MGEESMLLNGYRNEVYKMIGEGVPLRWESFINSHELFYADQQRQTPRALMPAAGADFGSVAKGTESKHGMFIRSF
AAAVSVLQAKATSLMHIHATVEQALKELGTCPYDASAFQPRLNTIQAAVDQLNLEQYVNLDYWVRGLNQKIQSIL
LGRLHAAIQAWIAAFEDDSPDDGGRRAKTAGGDGDDRQHGPAIKRLVLELAMRNQVIYLDPPLEHARASWFLLLH
DWIGIVCDLRKIKAARYQMSLTTNAADEPRFSELPIECAGMLHRVYVSVEKKLREVSAYVDKWLQFQSLWDLQSE
QVYDMLGDHLPRWLECLQDIRKVRTTFDTQEVSRSFGHITIDYDQVQTKVNAKYDQWQHEILIKFAGRLGNRMRD
VHADIERARKHLEGQSSDTSSTAQAVQFITAVQSCKRNVKLWAPEIDLFRQGQSTLVRQRYHFPQDWLHIEQVDS
QWEALKEILDKKSRIMEEQSDAMRANITAQDKLVNERICEIVALWNEEKPVSGTIQPDVASATLASFESRIATLQ
EEFLQVVKAKEALDLPASHDSSLEATLEEVRDFQSVWSSLSTIWASLNETRDMLWTAVQPRKVRNKVEDLIKSTK
EMPSRMRQYAAFEHVQGILRGFLKVNAILSDLKSDAIRERHWQKIYKQIRPQKRFSPSSMTLGDVWDLNLVATEA
IVKDIIAQAQGEMALEEFLKQVRETWQNYALEMVNYQNKCRLIRGWDELFAKCSENLNSLQAMKHSPYYKEFEEE
AVAWEDKLNRVHVLFDVWIDVQRQWVYLEGVFTGNADIKHLLPIESGRFQNINSEFLTVMKKANKTPYVLDVLNI
PNAQKSLERLAEMLNKIQKALGEYLEKERVSFPRFYFVGDEDLLEMIGNSNDTLRIAKHFKKMFAGLSGLVMDDE
SVITGFTSKEGETVKLKKEISVAKTPRINDWLALLEGGMKSTLAELLAEAVDQYTPLFEADDLLDGALRRFMDEY
PSQVVVLATQVVWTTAVEKSLAGGGGSLPVLLEREMQVLGVLADTVLGDLDVILRKKCEQLITECVHQRDAIDKL
IEAGADNTGHYLWLLQMRYVYTPEGDFLSRLHVSMANAKLNYGFEYLGVPDRLVRTPLTDRCFLTLTQALCQRLG
GSPYGPAGTGKTESVKALGVQLGRFTLVFCCDDTFDFQAMGRIFLGICQVGAWGCFDEFNRLEERILSAVSQQIQ
NIQLGLKQGAEDDASQIELVGRQLSVNENTGIFITMNPGYAGRSNLPDNLKKLFRSVAMSKPDKELIAEVMLYSQ
GFSQAKQLSKQTVPFFEQCSGRLSKQAHYDFGLRALKSVLVSSGGLKRARLNDGGGGGGEGVVEPEIIVQSIRET
IAPKLIKADVELMMGIEADCFPGVPYVPANLGDLEEAIRVLAAERHLVVTDTWMTKILQLYQIQKIHHGVMMVGN
SGSGKSAAWRLLLDALQKVEGVEGVFHVIDSKVMSKEALYGNLDPTTREWTDGLFTSILRKIVDNLRGEDAKRHW
IVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPANVRIMFEVETLRYATLATVSRCGMVWFSEDTVTPDMLV
AHYLETLGSVPFEDLDEDSVATGQTPARILAVQSQVADLLRSYLCADDFVARVLARAQEYDHIMDFTVARVLTTL
FSLLNKAVRDVIEYNGQHADFPLDADQVEAFVPKKLLLALVWALTGDCPLADRKAFGDDVCAMASFGSPPLDGSS
SSLIDFDVSLPKAEWTPWQNQVPTIEVNTHSITQTDVVIPTLDTVRHEDVLYSWLAEHKPLLLCGPPGSGKTMTL
FSALRKLPNMEVVGLNFSSATTPDLLIKTFEQYCEYKKTLNGVMLSPTQIGRWLVVFCDEINLPAPDKYGTQRAI
SFLRQLVEHNGFWRTSDKSWVTLDRIQFVGACNPPTDAGRTALGARFLRHAPLVMVDYPGELSLNQIYGTFNAAV
LKVVPSLRGYAEPLTQAMVRFYLESQRRFTPKIQPHYVYSPRELTRWVRGVYEAIRPLEGLSVEGLMRVWAHEAL
RLFQDRLVDESERAWTDEAVRRIALEHFPNVDEEKALGGPILFSNWLSRNYVPVEREQLREFVKARLKTFCEEEV
DVPLILFNDVLEHVLRIDRVFRQPQGHLILIGVSGSGKTTLSRFVAWMNGLKVFQIKVHGKYSADDFDEDLRDVL
RRCGCKGEKICFIMDEANVLDSGFLERMNTLLANAEVPGLFEGDEYAALMTACKEGAQRQNLHLDSPEELYRWFT
QQIVNNLHVVFTMNPPEGGLSSKAATSPALFNRCVLNWFGDWSDQALFQVGHELTQSVDLDRGGYQAPDSIPAAY
RGLSMPPSHREAVVNSMVYIHYSLRRYNEKLLRQQKKLTFLTPRHFLDFVGQFVRLYNEKREDLEEQQRHLNVGL
EKLRDTVDKVRDLRASLADKKTQLEHKDAEANEKLQRMVADQREAEQRRTTSLEIQQALEKQEAEVATRRRVVLE
DLAKAEPAVEEAKASVSNIKRQHLTEVRSMGNPPQGVRLALDAVCTLLGHRIVDWKAVQAVVRRDDFIASIIMFD
NGRQMTRALRAKMRNDFLSNPEFTFEKVNRASKACGPLVQWVAAQVNYSDILDRVGPLKDEVGQLEEQALQTKAE
ARAVEANISALEASIDTYKTEYAALISETQAIKAEMAKVQFKVDRSVRLLDSLSSERTRWEEGSRSFETQIGTLV
GDVLVAAAFVAYSGLYDQTFRKSMMDDWCHQLHLSGILYKSPNPVTEYLSTADERLGWQENTLPVDDLCTENAII
LKRFNRYPLIIDPSGRATEFLQRECRDRRLTVTSFLDDSFTKQLESSLRFGNPILIQDAEHLDPILNHVLNKEYQ
RTGGRVLMQLGKQEIDFSPSFRLYLSTRDPSAQFAPDICSRATFVNFTVTKSSLQTQSLNDVLKSERPDVDERRT
NLIKLQGEFKVHLRQLEKQLLQALNESRGNILDDDKVIETLETLKTEAADISAKMSSTEGVMAEVEDITRQYGII
ANSCSAVFAVLDQLHFLNHFYRFSLHYFLGIFRLVLHGNANLEGVADHDARRDIIVRDLFVNTFKRTALGLLQKD
RITLAVLLAQASPYAMDRGLIDVVLDGDVQGCDLSSEEAGEEARQEAMARAGRLPALRGRLERVSGEEWERFLTD
ELAEDCR*
Coding >Ophun1|6275
ATGGGCGAGGAGTCGATGCTGCTCAACGGCTACCGCAACGAGGTCTACAAGATGATCGGCGAGGGCGTGCCTCTG
CGCTGGGAGTCGTTTATCAACTCGCACGAGCTCTTCTACGCCGACCAGCAGCGCCAGACGCCCCGAGCCCTGATG
CCCGCGGCCGGTGCCGACTTTGGCAGCGTCGCCAAGGGTACAGAGAGCAAGCACGGCATGTTCATTCGGAGCTTC
GCCGCCGCCGTCTCCGTCCTGCAGGCCAAGGCCACGTCCCTGATGCACATTCACGCCACGGTCGAGCAGGCGCTC
AAGGAGTTGGGAACCTGCCCCTACGATGCCTCGGCTTTTCAGCCGCGCCTAAACACCATTCAGGCCGCTGTCGAT
CAGCTGAACCTGGAGCAGTACGTCAACCTCGACTACTGGGTGCGCGGCCTGAACCAGAAGATTCAGTCTATCCTG
CTCGGTCGTCTGCACGCCGCGATTCAGGCCTGGATCGCCGCCTTCGAGGACGACTCGCCCGACGATGGTGGCCGC
CGGGCAAAGACGGCGGGTGGTGATGGCGATGATAGGCAGCACGGTCCGGCTATCAAGCGTCTGGTGCTCGAGCTG
GCGATGCGGAACCAGGTCATCTACCTGGACCCTCCCTTGGAGCATGCCCGGGCCAGCTGGTTCCTCCTGCTCCAC
GACTGGATCGGTATCGTCTGCGATCTGCGCAAGATCAAGGCGGCCAGGTATCAGATGAGCCTCACGACCAACGCC
GCCGACGAGCCGCGCTTCTCGGAACTGCCGATCGAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAG
AAGAAGCTGCGAGAGGTCAGCGCCTACGTCGACAAGTGGCTTCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAG
CAGGTCTACGACATGCTGGGCGACCACCTCCCGCGATGGCTCGAGTGTCTGCAGGACATCCGCAAGGTCCGCACC
ACGTTTGATACGCAAGAGGTCAGCCGCTCGTTTGGACACATCACCATCGACTACGACCAGGTTCAGACCAAGGTC
AACGCAAAGTACGATCAGTGGCAGCACGAGATCCTCATCAAGTTCGCCGGCAGGCTGGGCAACCGCATGCGCGAC
GTGCACGCCGATATCGAAAGGGCGCGCAAGCATCTCGAGGGCCAGAGCTCTGACACGTCTTCGACGGCGCAGGCG
GTTCAGTTCATCACGGCCGTGCAGAGCTGCAAGCGCAATGTCAAGCTCTGGGCGCCTGAGATTGACCTCTTTCGT
CAGGGGCAGTCGACGCTGGTGCGCCAGCGATACCACTTCCCGCAAGACTGGCTTCACATCGAGCAGGTCGATAGT
CAGTGGGAGGCGCTCAAGGAGATACTCGACAAGAAGTCGCGCATCATGGAGGAGCAGTCTGACGCGATGAGGGCC
AACATTACGGCGCAGGACAAGCTGGTCAATGAGCGCATCTGCGAGATTGTCGCCCTGTGGAACGAGGAGAAGCCC
GTCTCCGGCACGATTCAGCCCGATGTAGCCTCTGCTACGCTGGCCTCGTTTGAGTCGCGCATCGCCACTTTGCAG
GAGGAGTTTTTGCAAGTTGTCAAGGCCAAGGAGGCGCTCGACCTACCCGCCTCGCACGACAGCTCCCTAGAGGCG
ACGCTCGAGGAGGTTCGGGACTTTCAGTCGGTCTGGTCCAGTCTCTCGACCATCTGGGCGAGCCTCAACGAGACG
CGCGACATGCTCTGGACGGCCGTACAGCCGCGCAAGGTGCGCAACAAGGTCGAGGACCTCATCAAGAGCACCAAG
GAGATGCCCAGTCGCATGAGGCAGTACGCCGCTTTCGAGCACGTCCAGGGCATTCTCCGAGGCTTTCTCAAGGTC
AACGCCATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGGCACTGGCAAAAGATATACAAGCAGATCCGG
CCGCAGAAGCGCTTCTCGCCGAGCTCCATGACGCTGGGAGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCC
ATTGTCAAGGACATCATTGCCCAGGCGCAGGGAGAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACG
TGGCAGAATTACGCGCTCGAGATGGTCAATTACCAGAACAAGTGTCGCCTTATTCGTGGCTGGGACGAGCTCTTT
GCCAAGTGCAGCGAGAACCTCAACTCGTTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTTGAGGAGGAG
GCCGTGGCGTGGGAGGACAAGCTGAACCGGGTTCACGTCTTGTTTGACGTCTGGATCGACGTTCAGCGCCAATGG
GTCTACCTCGAGGGCGTCTTCACCGGCAACGCCGATATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTTCAG
AACATCAACAGCGAGTTCCTGACCGTCATGAAAAAGGCCAACAAGACGCCCTACGTGCTCGACGTTCTCAACATC
CCCAACGCCCAGAAGTCGCTGGAGCGGCTGGCCGAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTG
GAAAAGGAGAGGGTCTCGTTCCCGCGCTTCTACTTTGTCGGCGATGAGGACCTGCTGGAGATGATTGGCAACAGC
AACGACACGCTGCGCATCGCCAAGCACTTCAAGAAGATGTTCGCCGGCCTGTCGGGTCTGGTCATGGACGACGAG
TCGGTCATCACGGGCTTCACCTCCAAGGAGGGCGAGACGGTCAAGCTGAAGAAGGAGATATCGGTGGCCAAGACG
CCGAGGATCAACGACTGGCTGGCTCTGCTCGAGGGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCC
GTGGATCAGTACACGCCCCTTTTCGAGGCCGACGACCTGTTGGACGGCGCGCTGAGGCGGTTCATGGACGAGTAC
CCGAGTCAGGTGGTGGTGCTGGCCACGCAGGTGGTGTGGACGACGGCGGTTGAAAAGTCGTTGGCCGGGGGCGGC
GGTTCGCTGCCGGTGCTGCTGGAGCGCGAGATGCAGGTTCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTC
GACGTCATTCTGCGCAAGAAGTGCGAGCAGCTCATCACCGAGTGCGTCCATCAGCGGGACGCCATCGACAAGCTC
ATCGAGGCTGGGGCCGACAACACTGGCCATTACCTGTGGCTGCTCCAGATGCGCTACGTCTACACGCCAGAAGGG
GACTTCCTCAGCCGGCTGCACGTCAGCATGGCCAATGCCAAGCTCAACTATGGCTTCGAGTACCTGGGCGTTCCG
GATCGTCTCGTGCGGACGCCCCTGACGGACCGGTGCTTTCTCACGTTGACGCAGGCCCTCTGCCAGCGTCTGGGA
GGCTCGCCGTATGGCCCGGCTGGCACGGGCAAGACGGAGTCGGTCAAGGCTCTCGGCGTCCAGCTCGGTCGCTTC
ACGCTCGTCTTTTGCTGTGACGACACGTTCGACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATCTGCCAGGTT
GGCGCCTGGGGATGCTTTGACGAGTTTAACCGGCTTGAGGAGAGGATTCTGTCGGCCGTTTCGCAGCAGATTCAG
AATATCCAGCTCGGTCTCAAGCAGGGCGCCGAAGACGATGCGTCGCAGATTGAGCTGGTGGGCCGCCAGCTGAGC
GTCAATGAGAACACGGGCATCTTCATCACCATGAATCCGGGCTACGCTGGCCGTTCCAACCTTCCGGACAATCTC
AAGAAGCTCTTTCGCAGCGTGGCCATGTCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCGCAG
GGCTTCAGCCAGGCCAAGCAGCTGTCCAAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCCGGCCGGCTGTCGAAG
CAGGCTCACTACGACTTTGGCCTCCGTGCCCTCAAGAGCGTCCTCGTCAGCTCAGGAGGGCTCAAGCGCGCTCGT
CTCAACGACGGTGGCGGCGGTGGCGGCGAGGGCGTGGTGGAACCGGAGATTATTGTGCAGAGCATCCGCGAGACT
ATCGCGCCCAAGCTGATCAAGGCCGACGTGGAGCTGATGATGGGCATCGAGGCCGACTGCTTCCCCGGTGTTCCG
TACGTGCCGGCCAACCTCGGGGACCTGGAGGAGGCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACG
GATACGTGGATGACCAAGATTCTCCAGCTGTATCAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAAC
TCGGGCAGCGGCAAGTCGGCTGCTTGGAGGTTGCTTCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTC
TTCCACGTCATCGACTCCAAGGTCATGTCCAAGGAGGCCCTGTACGGCAACCTGGATCCGACGACGCGCGAGTGG
ACCGACGGCTTGTTTACGAGCATCCTGCGCAAGATTGTCGACAATCTCAGGGGCGAGGACGCCAAGAGGCACTGG
ATCGTCTTTGACGGCGACGTCGATCCGGAATGGGTTGAGAATCTCAACAGCGTGCTCGACGACAATAAGCTGCTG
ACGCTGCCCAACGGCGAGCGGCTCAGCCTGCCGGCCAACGTGCGCATCATGTTCGAGGTTGAGACGCTGCGGTAC
GCGACGCTGGCGACGGTCAGTCGCTGCGGCATGGTCTGGTTCAGCGAGGATACGGTGACGCCGGACATGCTGGTG
GCTCACTACCTCGAGACGCTGGGCAGCGTCCCCTTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGGCAGACG
CCGGCGCGGATCCTGGCGGTTCAGTCTCAGGTGGCCGACCTGCTGCGGTCCTATCTTTGTGCCGACGACTTTGTG
GCGCGCGTGCTGGCGAGGGCTCAGGAGTACGACCACATCATGGACTTTACCGTTGCGCGCGTCCTGACGACGCTC
TTTTCTCTCCTCAACAAGGCGGTACGGGACGTCATCGAGTACAATGGCCAGCACGCCGATTTCCCCCTGGACGCG
GACCAGGTCGAGGCCTTTGTGCCCAAGAAGCTGCTGCTGGCGCTGGTGTGGGCGCTGACGGGCGACTGTCCGCTG
GCTGACCGCAAGGCCTTTGGCGACGACGTGTGTGCCATGGCCAGCTTCGGGTCTCCGCCGCTCGACGGCAGCAGC
AGCTCGCTCATCGACTTTGACGTCAGCCTGCCCAAGGCCGAGTGGACGCCCTGGCAGAACCAGGTGCCTACCATC
GAGGTCAACACCCACTCGATCACGCAGACGGACGTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGATGTG
CTCTACTCGTGGCTGGCTGAGCACAAGCCCTTGCTTCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTC
TTCAGTGCGCTTCGCAAGCTGCCCAACATGGAGGTGGTGGGCCTCAACTTTTCCAGCGCGACGACGCCCGATCTC
CTCATCAAGACGTTTGAGCAGTACTGCGAGTACAAGAAGACGCTCAACGGTGTGATGCTCTCGCCCACGCAGATC
GGTCGTTGGCTTGTCGTCTTCTGCGACGAGATCAACCTGCCGGCTCCGGACAAGTACGGCACGCAGCGGGCCATT
TCCTTCCTGAGGCAGCTGGTGGAACACAATGGCTTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGG
ATCCAGTTCGTCGGCGCCTGTAACCCGCCTACGGACGCGGGCAGGACGGCACTCGGGGCTCGCTTCCTCCGGCAC
GCGCCGCTCGTCATGGTCGACTATCCGGGCGAGCTCTCGCTGAACCAGATCTACGGCACCTTTAACGCGGCAGTG
CTCAAGGTGGTGCCGTCGCTGCGAGGGTACGCCGAGCCGCTGACGCAGGCCATGGTTCGCTTCTACCTCGAGTCG
CAGCGGCGGTTCACGCCCAAGATCCAGCCGCATTACGTCTACAGCCCGCGTGAGCTCACCCGCTGGGTCAGGGGC
GTGTACGAGGCCATCCGGCCGCTCGAGGGGCTGTCGGTTGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTG
CGTCTGTTCCAGGATCGGCTCGTGGATGAGTCGGAGAGGGCGTGGACGGACGAGGCTGTTCGGCGCATTGCGCTG
GAGCACTTCCCCAACGTCGACGAGGAAAAGGCGCTGGGCGGGCCCATTCTCTTCTCCAACTGGTTGTCGCGCAAC
TACGTGCCGGTTGAGAGGGAGCAGCTGCGCGAGTTTGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTT
GATGTCCCGCTGATTCTGTTCAACGACGTGCTGGAGCATGTGCTTCGCATCGACCGTGTCTTCCGGCAGCCGCAG
GGTCATTTGATACTGATTGGCGTCAGCGGCAGTGGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGC
CTCAAGGTGTTCCAGATCAAGGTCCATGGCAAGTATTCGGCCGACGACTTTGACGAGGATCTACGCGACGTGCTG
CGGAGGTGCGGCTGCAAGGGTGAGAAGATTTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTG
GAGCGCATGAATACGCTGCTGGCCAACGCCGAGGTTCCCGGTCTGTTCGAGGGCGACGAGTACGCTGCGCTGATG
ACGGCGTGTAAGGAGGGAGCGCAGCGGCAGAACCTGCACCTCGATTCCCCTGAAGAGCTGTATCGCTGGTTCACG
CAGCAGATTGTCAATAACCTGCACGTCGTCTTCACCATGAACCCGCCCGAGGGGGGATTGTCGTCCAAGGCGGCG
ACGAGTCCGGCGCTGTTCAACCGCTGCGTCCTCAACTGGTTCGGCGACTGGTCGGATCAGGCGCTCTTCCAGGTC
GGTCACGAGTTGACGCAGTCGGTCGACCTGGACCGCGGCGGTTACCAGGCTCCCGACTCGATACCGGCGGCGTAT
CGGGGCTTGTCGATGCCGCCTTCGCACCGCGAGGCCGTGGTCAACTCGATGGTCTATATTCACTACTCGCTGAGG
CGGTACAACGAGAAGTTGCTTCGACAGCAGAAGAAGCTGACGTTCCTGACGCCGCGGCACTTTCTCGACTTTGTG
GGCCAGTTCGTGCGGCTGTACAATGAGAAGCGGGAGGATCTGGAGGAGCAGCAGCGGCATCTCAACGTCGGGCTC
GAGAAGCTGCGCGACACGGTGGACAAGGTGCGCGATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAG
CACAAGGACGCCGAGGCCAACGAGAAGCTGCAGAGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGAGGACG
ACGTCGTTGGAGATTCAGCAGGCGTTGGAGAAGCAAGAGGCCGAGGTGGCGACGCGGCGACGAGTGGTGCTCGAG
GACCTGGCCAAGGCGGAACCGGCTGTCGAGGAGGCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACG
GAGGTTCGGTCCATGGGCAACCCGCCTCAGGGGGTGAGGCTGGCGCTGGATGCCGTGTGTACGCTGTTGGGACAC
CGGATCGTGGACTGGAAGGCGGTGCAGGCCGTGGTGCGGCGAGACGACTTTATCGCCAGCATCATCATGTTTGAC
AACGGGCGGCAGATGACGAGGGCTCTTCGGGCCAAGATGCGCAACGACTTCCTGTCCAACCCGGAGTTTACGTTT
GAAAAGGTCAACAGGGCGTCCAAGGCGTGCGGTCCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCTGAC
ATACTGGACCGCGTCGGGCCGCTCAAGGACGAGGTCGGCCAGCTGGAGGAACAGGCGCTGCAGACAAAGGCCGAG
GCGCGGGCGGTCGAGGCCAACATCAGCGCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTC
ATCAGCGAGACGCAGGCCATCAAGGCCGAGATGGCCAAGGTGCAGTTCAAGGTGGACCGCAGCGTGCGGCTGCTC
GACAGCCTGTCTTCGGAGAGGACGCGATGGGAGGAGGGCAGCCGGTCGTTTGAGACGCAGATTGGCACGCTGGTG
GGCGACGTGCTGGTGGCGGCCGCCTTTGTGGCCTACAGCGGCCTCTACGATCAGACGTTCCGCAAGTCCATGATG
GACGACTGGTGTCATCAGCTGCACCTCTCGGGCATCCTGTACAAGTCGCCCAACCCGGTGACGGAGTATCTGTCG
ACGGCGGACGAGCGGCTGGGCTGGCAGGAGAACACGCTGCCGGTGGACGATCTGTGCACGGAGAACGCCATCATC
CTGAAGCGCTTCAACCGCTATCCGCTCATCATCGATCCGTCTGGGAGGGCGACCGAGTTTCTGCAGCGCGAGTGT
CGGGATAGGCGGCTGACGGTGACGAGCTTCCTCGACGATAGCTTCACCAAGCAGCTGGAGAGCTCGTTGCGCTTC
GGCAACCCGATCCTGATACAGGACGCCGAACATCTGGATCCGATTCTCAACCACGTGCTCAACAAGGAGTATCAG
CGCACGGGGGGTCGGGTGCTGATGCAGCTGGGCAAGCAGGAGATTGACTTCTCGCCCTCGTTCCGGCTCTATCTC
TCGACGCGCGATCCGTCGGCTCAGTTCGCGCCTGATATCTGCAGCAGGGCTACCTTTGTCAACTTTACCGTCACC
AAGAGCAGTTTGCAGACGCAGTCGCTCAACGACGTGCTCAAGTCGGAGCGACCCGATGTCGACGAGCGGCGAACC
AACCTCATCAAGTTGCAGGGGGAGTTCAAGGTTCATCTACGACAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAAC
GAGTCGCGCGGCAACATCCTCGACGACGACAAGGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCTGCCGAT
ATTTCGGCCAAGATGAGCAGCACGGAGGGCGTCATGGCCGAGGTGGAGGACATCACGCGGCAGTACGGCATCATT
GCCAACTCTTGCAGTGCCGTGTTTGCCGTGTTGGATCAGCTGCACTTTCTCAACCACTTTTACCGCTTCTCGCTG
CATTACTTTCTCGGCATCTTTCGCTTGGTGTTGCACGGTAATGCGAATCTCGAGGGCGTGGCTGATCACGATGCC
CGTCGTGACATTATCGTTCGCGATCTGTTCGTCAACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGAT
CGCATCACGCTGGCGGTGCTGCTGGCTCAGGCGTCGCCCTATGCCATGGATAGGGGGCTGATTGACGTGGTGCTC
GATGGCGACGTTCAGGGGTGTGACTTGTCGTCGGAGGAGGCGGGCGAGGAGGCGCGTCAAGAGGCCATGGCTCGG
GCCGGACGGCTGCCTGCGCTACGGGGCCGGCTGGAGAGGGTGTCTGGTGAGGAGTGGGAGAGGTTCCTTACGGAC
GAGCTGGCCGAGGACTGCCGCTGA
Transcript >Ophun1|6275
ATGGGCGAGGAGTCGATGCTGCTCAACGGCTACCGCAACGAGGTCTACAAGATGATCGGCGAGGGCGTGCCTCTG
CGCTGGGAGTCGTTTATCAACTCGCACGAGCTCTTCTACGCCGACCAGCAGCGCCAGACGCCCCGAGCCCTGATG
CCCGCGGCCGGTGCCGACTTTGGCAGCGTCGCCAAGGGTACAGAGAGCAAGCACGGCATGTTCATTCGGAGCTTC
GCCGCCGCCGTCTCCGTCCTGCAGGCCAAGGCCACGTCCCTGATGCACATTCACGCCACGGTCGAGCAGGCGCTC
AAGGAGTTGGGAACCTGCCCCTACGATGCCTCGGCTTTTCAGCCGCGCCTAAACACCATTCAGGCCGCTGTCGAT
CAGCTGAACCTGGAGCAGTACGTCAACCTCGACTACTGGGTGCGCGGCCTGAACCAGAAGATTCAGTCTATCCTG
CTCGGTCGTCTGCACGCCGCGATTCAGGCCTGGATCGCCGCCTTCGAGGACGACTCGCCCGACGATGGTGGCCGC
CGGGCAAAGACGGCGGGTGGTGATGGCGATGATAGGCAGCACGGTCCGGCTATCAAGCGTCTGGTGCTCGAGCTG
GCGATGCGGAACCAGGTCATCTACCTGGACCCTCCCTTGGAGCATGCCCGGGCCAGCTGGTTCCTCCTGCTCCAC
GACTGGATCGGTATCGTCTGCGATCTGCGCAAGATCAAGGCGGCCAGGTATCAGATGAGCCTCACGACCAACGCC
GCCGACGAGCCGCGCTTCTCGGAACTGCCGATCGAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAG
AAGAAGCTGCGAGAGGTCAGCGCCTACGTCGACAAGTGGCTTCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAG
CAGGTCTACGACATGCTGGGCGACCACCTCCCGCGATGGCTCGAGTGTCTGCAGGACATCCGCAAGGTCCGCACC
ACGTTTGATACGCAAGAGGTCAGCCGCTCGTTTGGACACATCACCATCGACTACGACCAGGTTCAGACCAAGGTC
AACGCAAAGTACGATCAGTGGCAGCACGAGATCCTCATCAAGTTCGCCGGCAGGCTGGGCAACCGCATGCGCGAC
GTGCACGCCGATATCGAAAGGGCGCGCAAGCATCTCGAGGGCCAGAGCTCTGACACGTCTTCGACGGCGCAGGCG
GTTCAGTTCATCACGGCCGTGCAGAGCTGCAAGCGCAATGTCAAGCTCTGGGCGCCTGAGATTGACCTCTTTCGT
CAGGGGCAGTCGACGCTGGTGCGCCAGCGATACCACTTCCCGCAAGACTGGCTTCACATCGAGCAGGTCGATAGT
CAGTGGGAGGCGCTCAAGGAGATACTCGACAAGAAGTCGCGCATCATGGAGGAGCAGTCTGACGCGATGAGGGCC
AACATTACGGCGCAGGACAAGCTGGTCAATGAGCGCATCTGCGAGATTGTCGCCCTGTGGAACGAGGAGAAGCCC
GTCTCCGGCACGATTCAGCCCGATGTAGCCTCTGCTACGCTGGCCTCGTTTGAGTCGCGCATCGCCACTTTGCAG
GAGGAGTTTTTGCAAGTTGTCAAGGCCAAGGAGGCGCTCGACCTACCCGCCTCGCACGACAGCTCCCTAGAGGCG
ACGCTCGAGGAGGTTCGGGACTTTCAGTCGGTCTGGTCCAGTCTCTCGACCATCTGGGCGAGCCTCAACGAGACG
CGCGACATGCTCTGGACGGCCGTACAGCCGCGCAAGGTGCGCAACAAGGTCGAGGACCTCATCAAGAGCACCAAG
GAGATGCCCAGTCGCATGAGGCAGTACGCCGCTTTCGAGCACGTCCAGGGCATTCTCCGAGGCTTTCTCAAGGTC
AACGCCATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGGCACTGGCAAAAGATATACAAGCAGATCCGG
CCGCAGAAGCGCTTCTCGCCGAGCTCCATGACGCTGGGAGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCC
ATTGTCAAGGACATCATTGCCCAGGCGCAGGGAGAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACG
TGGCAGAATTACGCGCTCGAGATGGTCAATTACCAGAACAAGTGTCGCCTTATTCGTGGCTGGGACGAGCTCTTT
GCCAAGTGCAGCGAGAACCTCAACTCGTTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTTGAGGAGGAG
GCCGTGGCGTGGGAGGACAAGCTGAACCGGGTTCACGTCTTGTTTGACGTCTGGATCGACGTTCAGCGCCAATGG
GTCTACCTCGAGGGCGTCTTCACCGGCAACGCCGATATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTTCAG
AACATCAACAGCGAGTTCCTGACCGTCATGAAAAAGGCCAACAAGACGCCCTACGTGCTCGACGTTCTCAACATC
CCCAACGCCCAGAAGTCGCTGGAGCGGCTGGCCGAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTG
GAAAAGGAGAGGGTCTCGTTCCCGCGCTTCTACTTTGTCGGCGATGAGGACCTGCTGGAGATGATTGGCAACAGC
AACGACACGCTGCGCATCGCCAAGCACTTCAAGAAGATGTTCGCCGGCCTGTCGGGTCTGGTCATGGACGACGAG
TCGGTCATCACGGGCTTCACCTCCAAGGAGGGCGAGACGGTCAAGCTGAAGAAGGAGATATCGGTGGCCAAGACG
CCGAGGATCAACGACTGGCTGGCTCTGCTCGAGGGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCC
GTGGATCAGTACACGCCCCTTTTCGAGGCCGACGACCTGTTGGACGGCGCGCTGAGGCGGTTCATGGACGAGTAC
CCGAGTCAGGTGGTGGTGCTGGCCACGCAGGTGGTGTGGACGACGGCGGTTGAAAAGTCGTTGGCCGGGGGCGGC
GGTTCGCTGCCGGTGCTGCTGGAGCGCGAGATGCAGGTTCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTC
GACGTCATTCTGCGCAAGAAGTGCGAGCAGCTCATCACCGAGTGCGTCCATCAGCGGGACGCCATCGACAAGCTC
ATCGAGGCTGGGGCCGACAACACTGGCCATTACCTGTGGCTGCTCCAGATGCGCTACGTCTACACGCCAGAAGGG
GACTTCCTCAGCCGGCTGCACGTCAGCATGGCCAATGCCAAGCTCAACTATGGCTTCGAGTACCTGGGCGTTCCG
GATCGTCTCGTGCGGACGCCCCTGACGGACCGGTGCTTTCTCACGTTGACGCAGGCCCTCTGCCAGCGTCTGGGA
GGCTCGCCGTATGGCCCGGCTGGCACGGGCAAGACGGAGTCGGTCAAGGCTCTCGGCGTCCAGCTCGGTCGCTTC
ACGCTCGTCTTTTGCTGTGACGACACGTTCGACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATCTGCCAGGTT
GGCGCCTGGGGATGCTTTGACGAGTTTAACCGGCTTGAGGAGAGGATTCTGTCGGCCGTTTCGCAGCAGATTCAG
AATATCCAGCTCGGTCTCAAGCAGGGCGCCGAAGACGATGCGTCGCAGATTGAGCTGGTGGGCCGCCAGCTGAGC
GTCAATGAGAACACGGGCATCTTCATCACCATGAATCCGGGCTACGCTGGCCGTTCCAACCTTCCGGACAATCTC
AAGAAGCTCTTTCGCAGCGTGGCCATGTCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCGCAG
GGCTTCAGCCAGGCCAAGCAGCTGTCCAAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCCGGCCGGCTGTCGAAG
CAGGCTCACTACGACTTTGGCCTCCGTGCCCTCAAGAGCGTCCTCGTCAGCTCAGGAGGGCTCAAGCGCGCTCGT
CTCAACGACGGTGGCGGCGGTGGCGGCGAGGGCGTGGTGGAACCGGAGATTATTGTGCAGAGCATCCGCGAGACT
ATCGCGCCCAAGCTGATCAAGGCCGACGTGGAGCTGATGATGGGCATCGAGGCCGACTGCTTCCCCGGTGTTCCG
TACGTGCCGGCCAACCTCGGGGACCTGGAGGAGGCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACG
GATACGTGGATGACCAAGATTCTCCAGCTGTATCAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAAC
TCGGGCAGCGGCAAGTCGGCTGCTTGGAGGTTGCTTCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTC
TTCCACGTCATCGACTCCAAGGTCATGTCCAAGGAGGCCCTGTACGGCAACCTGGATCCGACGACGCGCGAGTGG
ACCGACGGCTTGTTTACGAGCATCCTGCGCAAGATTGTCGACAATCTCAGGGGCGAGGACGCCAAGAGGCACTGG
ATCGTCTTTGACGGCGACGTCGATCCGGAATGGGTTGAGAATCTCAACAGCGTGCTCGACGACAATAAGCTGCTG
ACGCTGCCCAACGGCGAGCGGCTCAGCCTGCCGGCCAACGTGCGCATCATGTTCGAGGTTGAGACGCTGCGGTAC
GCGACGCTGGCGACGGTCAGTCGCTGCGGCATGGTCTGGTTCAGCGAGGATACGGTGACGCCGGACATGCTGGTG
GCTCACTACCTCGAGACGCTGGGCAGCGTCCCCTTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGGCAGACG
CCGGCGCGGATCCTGGCGGTTCAGTCTCAGGTGGCCGACCTGCTGCGGTCCTATCTTTGTGCCGACGACTTTGTG
GCGCGCGTGCTGGCGAGGGCTCAGGAGTACGACCACATCATGGACTTTACCGTTGCGCGCGTCCTGACGACGCTC
TTTTCTCTCCTCAACAAGGCGGTACGGGACGTCATCGAGTACAATGGCCAGCACGCCGATTTCCCCCTGGACGCG
GACCAGGTCGAGGCCTTTGTGCCCAAGAAGCTGCTGCTGGCGCTGGTGTGGGCGCTGACGGGCGACTGTCCGCTG
GCTGACCGCAAGGCCTTTGGCGACGACGTGTGTGCCATGGCCAGCTTCGGGTCTCCGCCGCTCGACGGCAGCAGC
AGCTCGCTCATCGACTTTGACGTCAGCCTGCCCAAGGCCGAGTGGACGCCCTGGCAGAACCAGGTGCCTACCATC
GAGGTCAACACCCACTCGATCACGCAGACGGACGTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGATGTG
CTCTACTCGTGGCTGGCTGAGCACAAGCCCTTGCTTCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTC
TTCAGTGCGCTTCGCAAGCTGCCCAACATGGAGGTGGTGGGCCTCAACTTTTCCAGCGCGACGACGCCCGATCTC
CTCATCAAGACGTTTGAGCAGTACTGCGAGTACAAGAAGACGCTCAACGGTGTGATGCTCTCGCCCACGCAGATC
GGTCGTTGGCTTGTCGTCTTCTGCGACGAGATCAACCTGCCGGCTCCGGACAAGTACGGCACGCAGCGGGCCATT
TCCTTCCTGAGGCAGCTGGTGGAACACAATGGCTTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGG
ATCCAGTTCGTCGGCGCCTGTAACCCGCCTACGGACGCGGGCAGGACGGCACTCGGGGCTCGCTTCCTCCGGCAC
GCGCCGCTCGTCATGGTCGACTATCCGGGCGAGCTCTCGCTGAACCAGATCTACGGCACCTTTAACGCGGCAGTG
CTCAAGGTGGTGCCGTCGCTGCGAGGGTACGCCGAGCCGCTGACGCAGGCCATGGTTCGCTTCTACCTCGAGTCG
CAGCGGCGGTTCACGCCCAAGATCCAGCCGCATTACGTCTACAGCCCGCGTGAGCTCACCCGCTGGGTCAGGGGC
GTGTACGAGGCCATCCGGCCGCTCGAGGGGCTGTCGGTTGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTG
CGTCTGTTCCAGGATCGGCTCGTGGATGAGTCGGAGAGGGCGTGGACGGACGAGGCTGTTCGGCGCATTGCGCTG
GAGCACTTCCCCAACGTCGACGAGGAAAAGGCGCTGGGCGGGCCCATTCTCTTCTCCAACTGGTTGTCGCGCAAC
TACGTGCCGGTTGAGAGGGAGCAGCTGCGCGAGTTTGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTT
GATGTCCCGCTGATTCTGTTCAACGACGTGCTGGAGCATGTGCTTCGCATCGACCGTGTCTTCCGGCAGCCGCAG
GGTCATTTGATACTGATTGGCGTCAGCGGCAGTGGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGC
CTCAAGGTGTTCCAGATCAAGGTCCATGGCAAGTATTCGGCCGACGACTTTGACGAGGATCTACGCGACGTGCTG
CGGAGGTGCGGCTGCAAGGGTGAGAAGATTTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTG
GAGCGCATGAATACGCTGCTGGCCAACGCCGAGGTTCCCGGTCTGTTCGAGGGCGACGAGTACGCTGCGCTGATG
ACGGCGTGTAAGGAGGGAGCGCAGCGGCAGAACCTGCACCTCGATTCCCCTGAAGAGCTGTATCGCTGGTTCACG
CAGCAGATTGTCAATAACCTGCACGTCGTCTTCACCATGAACCCGCCCGAGGGGGGATTGTCGTCCAAGGCGGCG
ACGAGTCCGGCGCTGTTCAACCGCTGCGTCCTCAACTGGTTCGGCGACTGGTCGGATCAGGCGCTCTTCCAGGTC
GGTCACGAGTTGACGCAGTCGGTCGACCTGGACCGCGGCGGTTACCAGGCTCCCGACTCGATACCGGCGGCGTAT
CGGGGCTTGTCGATGCCGCCTTCGCACCGCGAGGCCGTGGTCAACTCGATGGTCTATATTCACTACTCGCTGAGG
CGGTACAACGAGAAGTTGCTTCGACAGCAGAAGAAGCTGACGTTCCTGACGCCGCGGCACTTTCTCGACTTTGTG
GGCCAGTTCGTGCGGCTGTACAATGAGAAGCGGGAGGATCTGGAGGAGCAGCAGCGGCATCTCAACGTCGGGCTC
GAGAAGCTGCGCGACACGGTGGACAAGGTGCGCGATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAG
CACAAGGACGCCGAGGCCAACGAGAAGCTGCAGAGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGAGGACG
ACGTCGTTGGAGATTCAGCAGGCGTTGGAGAAGCAAGAGGCCGAGGTGGCGACGCGGCGACGAGTGGTGCTCGAG
GACCTGGCCAAGGCGGAACCGGCTGTCGAGGAGGCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACG
GAGGTTCGGTCCATGGGCAACCCGCCTCAGGGGGTGAGGCTGGCGCTGGATGCCGTGTGTACGCTGTTGGGACAC
CGGATCGTGGACTGGAAGGCGGTGCAGGCCGTGGTGCGGCGAGACGACTTTATCGCCAGCATCATCATGTTTGAC
AACGGGCGGCAGATGACGAGGGCTCTTCGGGCCAAGATGCGCAACGACTTCCTGTCCAACCCGGAGTTTACGTTT
GAAAAGGTCAACAGGGCGTCCAAGGCGTGCGGTCCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCTGAC
ATACTGGACCGCGTCGGGCCGCTCAAGGACGAGGTCGGCCAGCTGGAGGAACAGGCGCTGCAGACAAAGGCCGAG
GCGCGGGCGGTCGAGGCCAACATCAGCGCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTC
ATCAGCGAGACGCAGGCCATCAAGGCCGAGATGGCCAAGGTGCAGTTCAAGGTGGACCGCAGCGTGCGGCTGCTC
GACAGCCTGTCTTCGGAGAGGACGCGATGGGAGGAGGGCAGCCGGTCGTTTGAGACGCAGATTGGCACGCTGGTG
GGCGACGTGCTGGTGGCGGCCGCCTTTGTGGCCTACAGCGGCCTCTACGATCAGACGTTCCGCAAGTCCATGATG
GACGACTGGTGTCATCAGCTGCACCTCTCGGGCATCCTGTACAAGTCGCCCAACCCGGTGACGGAGTATCTGTCG
ACGGCGGACGAGCGGCTGGGCTGGCAGGAGAACACGCTGCCGGTGGACGATCTGTGCACGGAGAACGCCATCATC
CTGAAGCGCTTCAACCGCTATCCGCTCATCATCGATCCGTCTGGGAGGGCGACCGAGTTTCTGCAGCGCGAGTGT
CGGGATAGGCGGCTGACGGTGACGAGCTTCCTCGACGATAGCTTCACCAAGCAGCTGGAGAGCTCGTTGCGCTTC
GGCAACCCGATCCTGATACAGGACGCCGAACATCTGGATCCGATTCTCAACCACGTGCTCAACAAGGAGTATCAG
CGCACGGGGGGTCGGGTGCTGATGCAGCTGGGCAAGCAGGAGATTGACTTCTCGCCCTCGTTCCGGCTCTATCTC
TCGACGCGCGATCCGTCGGCTCAGTTCGCGCCTGATATCTGCAGCAGGGCTACCTTTGTCAACTTTACCGTCACC
AAGAGCAGTTTGCAGACGCAGTCGCTCAACGACGTGCTCAAGTCGGAGCGACCCGATGTCGACGAGCGGCGAACC
AACCTCATCAAGTTGCAGGGGGAGTTCAAGGTTCATCTACGACAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAAC
GAGTCGCGCGGCAACATCCTCGACGACGACAAGGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCTGCCGAT
ATTTCGGCCAAGATGAGCAGCACGGAGGGCGTCATGGCCGAGGTGGAGGACATCACGCGGCAGTACGGCATCATT
GCCAACTCTTGCAGTGCCGTGTTTGCCGTGTTGGATCAGCTGCACTTTCTCAACCACTTTTACCGCTTCTCGCTG
CATTACTTTCTCGGCATCTTTCGCTTGGTGTTGCACGGTAATGCGAATCTCGAGGGCGTGGCTGATCACGATGCC
CGTCGTGACATTATCGTTCGCGATCTGTTCGTCAACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGAT
CGCATCACGCTGGCGGTGCTGCTGGCTCAGGCGTCGCCCTATGCCATGGATAGGGGGCTGATTGACGTGGTGCTC
GATGGCGACGTTCAGGGGTGTGACTTGTCGTCGGAGGAGGCGGGCGAGGAGGCGCGTCAAGAGGCCATGGCTCGG
GCCGGACGGCTGCCTGCGCTACGGGGCCGGCTGGAGAGGGTGTCTGGTGAGGAGTGGGAGAGGTTCCTTACGGAC
GAGCTGGCCGAGGACTGCCGCTGA
Gene >Ophun1|6275
ATGGGCGAGGAGTCGATGCTGCTCAACGGCTACCGCAACGAGGTCTACAAGATGATCGGCGAGGGCGTGCCTCTG
CGCTGGGAGTCGTTTATCAACTCGCACGAGCTCTTCTACGCCGACCAGCAGCGCCAGACGCCCCGAGCCCTGATG
CCCGCGGCCGGTGCCGACTTTGGCAGCGTCGCCAAGGGTACAGAGAGCAAGCACGGCATGTTCATTCGGAGCTTC
GCCGCCGCCGTCTCCGTCCTGCAGGCCAAGGCCACGTCCCTGATGCACATTCACGCCACGGTCGAGCAGGCGCTC
AAGGAGTTGGGAACCTGCCCCTACGATGCCTCGGCTTTTCAGCCGCGCCTAAACACCATTCAGGCCGCTGTCGAT
CAGCTGAACCTGGAGCAGTACGTCAACCTCGACTACTGGGTGCGCGGCCTGAACCAGAAGATTCAGTCTATCCTG
CTCGGTCGTCTGCACGCCGCGATTCAGGCCTGGATCGCCGCCTTCGAGGACGACTCGCCCGACGATGGTGGCCGC
CGGGCAAAGACGGCGGGTGGTGATGGCGATGATAGGCAGCACGGTCCGGCTATCAAGCGTCTGGTGCTCGAGCTG
GCGATGCGGAACCAGGTCATCTACCTGGACCCTCCCTTGGAGCATGCCCGGGCCAGCTGGTTCCTCCTGCTCCAC
GACTGGATCGGTATCGTCTGCGATCTGCGCAAGATCAAGGCGGCCAGGTATCAGATGAGCCTCACGACCAACGCC
GCCGACGAGCCGCGCTTCTCGGAACTGCCGATCGAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAG
AAGAAGCTGCGAGAGGTCAGCGCCTACGTCGACAAGTGGCTTCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAG
CAGGTCTACGACATGCTGGGCGACCACCTCCCGCGATGGCTCGAGTGTCTGCAGGACATCCGCAAGGTCCGCACC
ACGTTTGATACGCAAGAGGTCAGCCGCTCGTTTGGACACATCACCATCGACTACGACCAGGTTCAGACCAAGGTC
AACGCAAAGTACGATCAGTGGCAGCACGAGATCCTCATCAAGTTCGCCGGCAGGCTGGGCAACCGCATGCGCGAC
GTGCACGCCGATATCGAAAGGGCGCGCAAGCATCTCGAGGGCCAGAGCTCTGACACGTCTTCGACGGCGCAGGCG
GTTCAGTTCATCACGGCCGTGCAGAGCTGCAAGCGCAATGTCAAGCTCTGGGCGCCTGAGATTGACCTCTTTCGT
CAGGGGCAGTCGACGCTGGTGCGCCAGCGATACCACTTCCCGCAAGACTGGCTTCACATCGAGCAGGTCGATAGT
CAGTGGGAGGCGCTCAAGGAGATACTCGACAAGAAGTCGCGCATCATGGAGGAGCAGTCTGACGCGATGAGGGCC
AACATTACGGCGCAGGACAAGCTGGTCAATGAGCGCATCTGCGAGATTGTCGCCCTGTGGAACGAGGAGAAGCCC
GTCTCCGGCACGATTCAGCCCGATGTAGCCTCTGCTACGCTGGCCTCGTTTGAGTCGCGCATCGCCACTTTGCAG
GAGGAGTTTTTGCAAGTTGTCAAGGCCAAGGAGGCGCTCGACCTACCCGCCTCGCACGACAGCTCCCTAGAGGCG
ACGCTCGAGGAGGTTCGGGACTTTCAGTCGGTCTGGTCCAGTCTCTCGACCATCTGGGCGAGCCTCAACGAGACG
CGCGACATGCTCTGGACGGCCGTACAGCCGCGCAAGGTGCGCAACAAGGTCGAGGACCTCATCAAGAGCACCAAG
GAGATGCCCAGTCGCATGAGGCAGTACGCCGCTTTCGAGCACGTCCAGGGCATTCTCCGAGGCTTTCTCAAGGTC
AACGCCATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGGCACTGGCAAAAGATATACAAGCAGATCCGG
CCGCAGAAGCGCTTCTCGCCGAGCTCCATGACGCTGGGAGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCC
ATTGTCAAGGACATCATTGCCCAGGCGCAGGGAGAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACG
TGGCAGAATTACGCGCTCGAGATGGTCAATTACCAGAACAAGTGTCGCCTTATTCGTGGCTGGGACGAGCTCTTT
GCCAAGTGCAGCGAGAACCTCAACTCGTTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTTGAGGAGGAG
GCCGTGGCGTGGGAGGACAAGCTGAACCGGGTTCACGTCTTGTTTGACGTCTGGATCGACGTTCAGCGCCAATGG
GTCTACCTCGAGGGCGTCTTCACCGGCAACGCCGATATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTTCAG
AACATCAACAGCGAGTTCCTGACCGTCATGAAAAAGGCCAACAAGACGCCCTACGTGCTCGACGTTCTCAACATC
CCCAACGCCCAGAAGTCGCTGGAGCGGCTGGCCGAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTG
GAAAAGGAGAGGGTCTCGTTCCCGCGCTTCTACTTTGTCGGCGATGAGGACCTGCTGGAGATGATTGGCAACAGC
AACGACACGCTGCGCATCGCCAAGCACTTCAAGAAGATGTTCGCCGGCCTGTCGGGTCTGGTCATGGACGACGAG
TCGGTCATCACGGGCTTCACCTCCAAGGAGGGCGAGACGGTCAAGCTGAAGAAGGAGATATCGGTGGCCAAGACG
CCGAGGATCAACGACTGGCTGGCTCTGCTCGAGGGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCC
GTGGATCAGTACACGCCCCTTTTCGAGGCCGACGACCTGTTGGACGGCGCGCTGAGGCGGTTCATGGACGAGTAC
CCGAGTCAGGTGGTGGTGCTGGCCACGCAGGTGGTGTGGACGACGGCGGTTGAAAAGTCGTTGGCCGGGGGCGGC
GGTTCGCTGCCGGTGCTGCTGGAGCGCGAGATGCAGGTTCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTC
GACGTCATTCTGCGCAAGAAGTGCGAGCAGCTCATCACCGAGTGCGTCCATCAGCGGGACGCCATCGACAAGCTC
ATCGAGGCTGGGGCCGACAACACTGGCCATTACCTGTGGCTGCTCCAGATGCGCTACGTCTACACGCCAGAAGGG
GACTTCCTCAGCCGGCTGCACGTCAGCATGGCCAATGCCAAGCTCAACTATGGCTTCGAGTACCTGGGCGTTCCG
GATCGTCTCGTGCGGACGCCCCTGACGGACCGGTGCTTTCTCACGTTGACGCAGGCCCTCTGCCAGCGTCTGGGA
GGCTCGCCGTATGGCCCGGCTGGCACGGGCAAGACGGAGTCGGTCAAGGCTCTCGGCGTCCAGCTCGGTCGCTTC
ACGCTCGTCTTTTGCTGTGACGACACGTTCGACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATCTGCCAGGTT
GGCGCCTGGGGATGCTTTGACGAGTTTAACCGGCTTGAGGAGAGGATTCTGTCGGCCGTTTCGCAGCAGATTCAG
AATATCCAGCTCGGTCTCAAGCAGGGCGCCGAAGACGATGCGTCGCAGATTGAGCTGGTGGGCCGCCAGCTGAGC
GTCAATGAGAACACGGGCATCTTCATCACCATGAATCCGGGCTACGCTGGCCGTTCCAACCTTCCGGACAATCTC
AAGAAGCTCTTTCGCAGCGTGGCCATGTCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCGCAG
GGCTTCAGCCAGGCCAAGCAGCTGTCCAAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCCGGCCGGCTGTCGAAG
CAGGCTCACTACGACTTTGGCCTCCGTGCCCTCAAGAGCGTCCTCGTCAGCTCAGGAGGGCTCAAGCGCGCTCGT
CTCAACGACGGTGGCGGCGGTGGCGGCGAGGGCGTGGTGGAACCGGAGATTATTGTGCAGAGCATCCGCGAGACT
ATCGCGCCCAAGCTGATCAAGGCCGACGTGGAGCTGATGATGGGCATCGAGGCCGACTGCTTCCCCGGTGTTCCG
TACGTGCCGGCCAACCTCGGGGACCTGGAGGAGGCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACG
GATACGTGGATGACCAAGATTCTCCAGCTGTATCAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAAC
TCGGGCAGCGGCAAGTCGGCTGCTTGGAGGTTGCTTCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTC
TTCCACGTCATCGACTCCAAGGTCATGTCCAAGGAGGCCCTGTACGGCAACCTGGATCCGACGACGCGCGAGTGG
ACCGACGGCTTGTTTACGAGCATCCTGCGCAAGATTGTCGACAATCTCAGGGGCGAGGACGCCAAGAGGCACTGG
ATCGTCTTTGACGGCGACGTCGATCCGGAATGGGTTGAGAATCTCAACAGCGTGCTCGACGACAATAAGCTGCTG
ACGCTGCCCAACGGCGAGCGGCTCAGCCTGCCGGCCAACGTGCGCATCATGTTCGAGGTTGAGACGCTGCGGTAC
GCGACGCTGGCGACGGTCAGTCGCTGCGGCATGGTCTGGTTCAGCGAGGATACGGTGACGCCGGACATGCTGGTG
GCTCACTACCTCGAGACGCTGGGCAGCGTCCCCTTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGGCAGACG
CCGGCGCGGATCCTGGCGGTTCAGTCTCAGGTGGCCGACCTGCTGCGGTCCTATCTTTGTGCCGACGACTTTGTG
GCGCGCGTGCTGGCGAGGGCTCAGGAGTACGACCACATCATGGACTTTACCGTTGCGCGCGTCCTGACGACGCTC
TTTTCTCTCCTCAACAAGGCGGTACGGGACGTCATCGAGTACAATGGCCAGCACGCCGATTTCCCCCTGGACGCG
GACCAGGTCGAGGCCTTTGTGCCCAAGAAGCTGCTGCTGGCGCTGGTGTGGGCGCTGACGGGCGACTGTCCGCTG
GCTGACCGCAAGGCCTTTGGCGACGACGTGTGTGCCATGGCCAGCTTCGGGTCTCCGCCGCTCGACGGCAGCAGC
AGCTCGCTCATCGACTTTGACGTCAGCCTGCCCAAGGCCGAGTGGACGCCCTGGCAGAACCAGGTGCCTACCATC
GAGGTCAACACCCACTCGATCACGCAGACGGACGTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGATGTG
CTCTACTCGTGGCTGGCTGAGCACAAGCCCTTGCTTCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTC
TTCAGTGCGCTTCGCAAGCTGCCCAACATGGAGGTGGTGGGCCTCAACTTTTCCAGCGCGACGACGCCCGATCTC
CTCATCAAGACGTTTGAGCAGTACTGCGAGTACAAGAAGACGCTCAACGGTGTGATGCTCTCGCCCACGCAGATC
GGTCGTTGGCTTGTCGTCTTCTGCGACGAGATCAACCTGCCGGCTCCGGACAAGTACGGCACGCAGCGGGCCATT
TCCTTCCTGAGGCAGCTGGTGGAACACAATGGCTTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGG
ATCCAGTTCGTCGGCGCCTGTAACCCGCCTACGGACGCGGGCAGGACGGCACTCGGGGCTCGCTTCCTCCGGCAC
GCGCCGCTCGTCATGGTCGACTATCCGGGCGAGCTCTCGCTGAACCAGATCTACGGCACCTTTAACGCGGCAGTG
CTCAAGGTGGTGCCGTCGCTGCGAGGGTACGCCGAGCCGCTGACGCAGGCCATGGTTCGCTTCTACCTCGAGTCG
CAGCGGCGGTTCACGCCCAAGATCCAGCCGCATTACGTCTACAGCCCGCGTGAGCTCACCCGCTGGGTCAGGGGC
GTGTACGAGGCCATCCGGCCGCTCGAGGGGCTGTCGGTTGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTG
CGTCTGTTCCAGGATCGGCTCGTGGATGAGTCGGAGAGGGCGTGGACGGACGAGGCTGTTCGGCGCATTGCGCTG
GAGCACTTCCCCAACGTCGACGAGGAAAAGGCGCTGGGCGGGCCCATTCTCTTCTCCAACTGGTTGTCGCGCAAC
TACGTGCCGGTTGAGAGGGAGCAGCTGCGCGAGTTTGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTT
GATGTCCCGCTGATTCTGTTCAACGACGTGCTGGAGCATGTGCTTCGCATCGACCGTGTCTTCCGGCAGCCGCAG
GGTCATTTGATACTGATTGGCGTCAGCGGCAGTGGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGC
CTCAAGGTGTTCCAGATCAAGGTCCATGGCAAGTATTCGGCCGACGACTTTGACGAGGATCTACGCGACGTGCTG
CGGAGGTGCGGCTGCAAGGGTGAGAAGATTTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTG
GAGCGCATGAATACGCTGCTGGCCAACGCCGAGGTTCCCGGTCTGTTCGAGGGCGACGAGTACGCTGCGCTGATG
ACGGCGTGTAAGGAGGGAGCGCAGCGGCAGAACCTGCACCTCGATTCCCCTGAAGAGCTGTATCGCTGGTTCACG
CAGCAGATTGTCAATAACCTGCACGTCGTCTTCACCATGAACCCGCCCGAGGGGGGATTGTCGTCCAAGGCGGCG
ACGAGTCCGGCGCTGTTCAACCGCTGCGTCCTCAACTGGTTCGGCGACTGGTCGGATCAGGCGCTCTTCCAGGTC
GGTCACGAGTTGACGCAGTCGGTCGACCTGGACCGCGGCGGTTACCAGGCTCCCGACTCGATACCGGCGGCGTAT
CGGGGCTTGTCGATGCCGCCTTCGCACCGCGAGGCCGTGGTCAACTCGATGGTCTATATTCACTACTCGCTGAGG
CGGTACAACGAGAAGTTGCTTCGACAGCAGAAGAAGCTGACGTTCCTGACGCCGCGGCACTTTCTCGACTTTGTG
GGCCAGTTCGTGCGGCTGTACAATGAGAAGCGGGAGGATCTGGAGGAGCAGCAGCGGCATCTCAACGTCGGGCTC
GAGAAGCTGCGCGACACGGTGGACAAGGTGCGCGATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAG
CACAAGGACGCCGAGGCCAACGAGAAGCTGCAGAGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGAGGACG
ACGTCGTTGGAGATTCAGCAGGCGTTGGAGAAGCAAGAGGCCGAGGTGGCGACGCGGCGACGAGTGGTGCTCGAG
GACCTGGCCAAGGCGGAACCGGCTGTCGAGGAGGCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACG
GAGGTTCGGTCCATGGGCAACCCGCCTCAGGGGGTGAGGCTGGCGCTGGATGCCGTGTGTACGCTGTTGGGACAC
CGGATCGTGGACTGGAAGGCGGTGCAGGCCGTGGTGCGGCGAGACGACTTTATCGCCAGCATCATCATGTTTGAC
AACGGGCGGCAGATGACGAGGGCTCTTCGGGCCAAGATGCGCAACGACTTCCTGTCCAACCCGGAGTTTACGTTT
GAAAAGGTCAACAGGGCGTCCAAGGCGTGCGGTCCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCTGAC
ATACTGGACCGCGTCGGGCCGCTCAAGGACGAGGTCGGCCAGCTGGAGGAACAGGCGCTGCAGACAAAGGCCGAG
GCGCGGGCGGTCGAGGCCAACATCAGCGCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTC
ATCAGCGAGACGCAGGCCATCAAGGCCGAGATGGCCAAGGTGCAGTTCAAGGTGGACCGCAGCGTGCGGCTGCTC
GACAGCCTGTCTTCGGAGAGGACGCGATGGGAGGAGGGCAGCCGGTCGTTTGAGACGCAGATTGGCACGCTGGTG
GGCGACGTGCTGGTGGCGGCCGCCTTTGTGGCCTACAGCGGCCTCTACGATCAGACGTTCCGCAAGTCCATGATG
GACGACTGGTGTCATCAGCTGCACCTCTCGGGCATCCTGTACAAGTCGCCCAACCCGGTGACGGAGTATCTGTCG
ACGGCGGACGAGCGGCTGGGCTGGCAGGAGAACACGCTGCCGGTGGACGATCTGTGCACGGAGAACGCCATCATC
CTGAAGCGCTTCAACCGCTATCCGCTCATCATCGATCCGTCTGGGAGGGCGACCGAGTTTCTGCAGCGCGAGTGT
CGGGATAGGCGGCTGACGGTGACGAGCTTCCTCGACGATAGCTTCACCAAGCAGCTGGAGAGCTCGTTGCGCTTC
GGCAACCCGATCCTGATACAGGACGCCGAACATCTGGATCCGATTCTCAACCACGTGCTCAACAAGGAGTATCAG
CGCACGGGGGGTCGGGTGCTGATGCAGCTGGGCAAGCAGGAGATTGACTTCTCGCCCTCGTTCCGGCTCTATCTC
TCGACGCGCGATCCGTCGGCTCAGTTCGCGCCTGATATCTGCAGCAGGGCTACCTTTGTCAACTTTACCGTCACC
AAGAGCAGTTTGCAGACGCAGTCGCTCAACGACGTGCTCAAGTCGGAGCGACCCGATGTCGACGAGCGGCGAACC
AACCTCATCAAGTTGCAGGGGGAGTTCAAGGTTCATCTACGACAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAAC
GAGTCGCGCGGCAACATCCTCGACGACGACAAGGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCTGCCGAT
ATTTCGGCCAAGATGAGCAGCACGGAGGGCGTCATGGCCGAGGTGGAGGACATCACGCGGCAGTACGGCATCATT
GCCAACTCTTGCAGTGCCGTGTTTGCCGTGTTGGATCAGCTGCACTTTCTCAACCACTTTTACCGCTTCTCGCTG
CATTACTTTCTCGGCATCTTTCGCTTGGTGTTGCACGGTAATGCGAATCTCGAGGGCGTGGCTGATCACGATGCC
CGTCGTGACATTATCGTTCGCGATCTGTTCGTCAACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGAT
CGCATCACGCTGGCGGTGCTGCTGGCTCAGGCGTCGCCCTATGCCATGGATAGGGGGCTGATTGACGTGGTGCTC
GATGGCGACGTTCAGGGGTGTGACTTGTCGTCGGAGGAGGCGGGCGAGGAGGCGCGTCAAGAGGCCATGGCTCGG
GCCGGACGGCTGCCTGCGCTACGGGGCCGGCTGGAGAGGGTGTCTGGTGAGGAGTGGGAGAGGTTCCTTACGGAC
GAGCTGGCCGAGGACTGCGTGCCGCGGGGGCTGTTGGGCGGTGACGAGGATGACGAGGGTGCGAAGAGGGCAGCG
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail