Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6274
Gene name
LocationContig_674:7147..8705
Strand+
Gene length (bp)1558
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.9E-24 81 402

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6DCX5|PCFT_XENLA Proton-coupled folate transporter OS=Xenopus laevis GN=slc46a1 PE=2 SV=1 69 402 3.0E-10
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 74 408 9.0E-07

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 111 130 19
3 140 162 22
4 175 197 22
5 201 220 19
6 264 286 22
7 306 325 19
8 338 360 22
9 420 442 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6274
MEETTPLLGRADSSRARSIVILLSLVVFCLSCFGSLGSVPLNRLLEDRICRRYGADYARLSFIDEQVCKADAVQS
QLAHLNGLLDTLEAVVGLLVAFPYGALSDKVGRKPIILLSITGFTLSSAWIAHILAHQETSIQAILLAPVFFLIG
GGRHVTFSTLFSAVSDVTTHENRHVITPSIFMGGVIGPVVSSGLMQVASPWLPFLLSFGMGLIGAIILLLVPETL
PLDKHEQDDDPVHDKTAVLPGHHLSLLRASLSMLWHPKLALILVTFLAPMPMSTAANQFLVQYISKRFGWSMADA
GYLQSIRGAINVFLLLAILPFLSRLLKDRTLARLSALAMTLGCLLMAGSSMPLLVTGLIINTLGNGLAPLCRSLA
ASLVAHHEQARLQTLIAMVEASGSLLAGPTLAAALSTGMRMGGDWMGIPYFALAIFLFLTTFPLFLLSRLGETIE
AKDHHDQDV*
Coding >Ophun1|6274
ATGGAGGAGACGACGCCTCTCCTGGGCCGAGCCGACAGCTCGCGAGCTCGGTCCATTGTCATTCTTTTATCCCTC
GTCGTCTTCTGCCTGTCTTGCTTCGGCTCCCTCGGTAGCGTTCCGCTGAATCGTCTGCTCGAGGACCGTATCTGT
CGACGATATGGCGCTGACTACGCCCGACTCTCCTTCATCGACGAGCAGGTCTGCAAGGCAGACGCTGTTCAGTCG
CAACTCGCCCATCTCAACGGGCTGCTCGATACGCTCGAGGCCGTCGTTGGCCTTCTGGTCGCTTTCCCTTACGGG
GCTCTGTCTGACAAGGTCGGACGAAAGCCCATCATTCTGCTGTCCATCACTGGCTTCACCCTCTCTTCGGCGTGG
ATAGCCCATATCCTAGCCCATCAAGAGACGTCGATTCAAGCCATCCTCCTCGCCCCAGTCTTCTTCTTAATCGGC
GGCGGCAGACACGTCACCTTCTCTACCCTCTTCTCAGCCGTCTCCGATGTGACGACGCATGAAAACCGGCACGTC
ATCACCCCTTCCATCTTCATGGGAGGAGTCATCGGGCCCGTAGTCTCATCAGGTCTCATGCAGGTCGCCAGCCCA
TGGCTCCCGTTTCTACTGAGCTTTGGCATGGGACTCATCGGAGCAATCATACTGCTGCTCGTGCCCGAGACTCTC
CCCCTCGACAAACACGAGCAAGACGACGACCCCGTCCATGACAAGACGGCCGTCCTTCCCGGCCACCACCTCTCC
CTTCTCAGAGCCTCACTGAGCATGCTTTGGCATCCCAAACTGGCCCTCATCCTCGTCACCTTCCTGGCCCCGATG
CCCATGTCAACGGCAGCAAACCAGTTCCTCGTCCAGTACATCAGCAAGCGCTTCGGCTGGTCCATGGCCGACGCC
GGCTACCTGCAGTCAATCCGCGGAGCCATCAACGTCTTCCTCCTACTCGCCATCCTCCCTTTCCTGAGCCGCCTG
CTCAAAGACCGAACCCTAGCCCGACTATCAGCCCTCGCCATGACCCTCGGCTGCCTCCTCATGGCCGGCTCCAGC
ATGCCGCTGCTGGTAACCGGCCTCATCATCAACACGCTGGGCAACGGCCTGGCCCCCCTTTGCCGCTCCCTGGCA
GCCAGCCTCGTCGCCCACCACGAGCAGGCCAGGCTACAGACGCTGATTGCCATGGTCGAGGCCTCGGGCTCGCTG
CTCGCGGGTCCGACCCTTGCTGCTGCGCTGTCGACTGGCATGCGTATGGGCGGCGACTGGATGGGGATTCCGTAC
TTTGCTCTGGCCATCTTCTTATTCCTCACTACTTTCCCCTTGTTCTTGTTATCGAGGCTAGGGGAAACGATCGAG
GCCAAGGATCACCATGACCAAGACGTCTGA
Transcript >Ophun1|6274
ATGGAGGAGACGACGCCTCTCCTGGGCCGAGCCGACAGCTCGCGAGCTCGGTCCATTGTCATTCTTTTATCCCTC
GTCGTCTTCTGCCTGTCTTGCTTCGGCTCCCTCGGTAGCGTTCCGCTGAATCGTCTGCTCGAGGACCGTATCTGT
CGACGATATGGCGCTGACTACGCCCGACTCTCCTTCATCGACGAGCAGGTCTGCAAGGCAGACGCTGTTCAGTCG
CAACTCGCCCATCTCAACGGGCTGCTCGATACGCTCGAGGCCGTCGTTGGCCTTCTGGTCGCTTTCCCTTACGGG
GCTCTGTCTGACAAGGTCGGACGAAAGCCCATCATTCTGCTGTCCATCACTGGCTTCACCCTCTCTTCGGCGTGG
ATAGCCCATATCCTAGCCCATCAAGAGACGTCGATTCAAGCCATCCTCCTCGCCCCAGTCTTCTTCTTAATCGGC
GGCGGCAGACACGTCACCTTCTCTACCCTCTTCTCAGCCGTCTCCGATGTGACGACGCATGAAAACCGGCACGTC
ATCACCCCTTCCATCTTCATGGGAGGAGTCATCGGGCCCGTAGTCTCATCAGGTCTCATGCAGGTCGCCAGCCCA
TGGCTCCCGTTTCTACTGAGCTTTGGCATGGGACTCATCGGAGCAATCATACTGCTGCTCGTGCCCGAGACTCTC
CCCCTCGACAAACACGAGCAAGACGACGACCCCGTCCATGACAAGACGGCCGTCCTTCCCGGCCACCACCTCTCC
CTTCTCAGAGCCTCACTGAGCATGCTTTGGCATCCCAAACTGGCCCTCATCCTCGTCACCTTCCTGGCCCCGATG
CCCATGTCAACGGCAGCAAACCAGTTCCTCGTCCAGTACATCAGCAAGCGCTTCGGCTGGTCCATGGCCGACGCC
GGCTACCTGCAGTCAATCCGCGGAGCCATCAACGTCTTCCTCCTACTCGCCATCCTCCCTTTCCTGAGCCGCCTG
CTCAAAGACCGAACCCTAGCCCGACTATCAGCCCTCGCCATGACCCTCGGCTGCCTCCTCATGGCCGGCTCCAGC
ATGCCGCTGCTGGTAACCGGCCTCATCATCAACACGCTGGGCAACGGCCTGGCCCCCCTTTGCCGCTCCCTGGCA
GCCAGCCTCGTCGCCCACCACGAGCAGGCCAGGCTACAGACGCTGATTGCCATGGTCGAGGCCTCGGGCTCGCTG
CTCGCGGGTCCGACCCTTGCTGCTGCGCTGTCGACTGGCATGCGTATGGGCGGCGACTGGATGGGGATTCCGTAC
TTTGCTCTGGCCATCTTCTTATTCCTCACTACTTTCCCCTTGTTCTTGTTATCGAGGCTAGGGGAAACGATCGAG
GCCAAGGATCACCATGACCAAGACGTCTGA
Gene >Ophun1|6274
ATGGAGGAGACGACGCCTCTCCTGGGCCGAGCCGACAGCTCGCGAGCTCGGTCCATTGTCATTCTTTTATCCCTC
GTCGTCTTCTGCCTGTCTTGCTTCGGCTCCCTCGGTAGCGTTCCGCTGAATCGTCTGCTCGAGGACCGTATCTGT
CGACGATATGGCGCTGACTACGCCCGACTCTCCTTCATCGACGAGCAGGTCTGCAAGGCAGACGCTGTTCAGTCG
CAACTCGCCCATCTCAACGGGCTGCTCGATACGCTCGAGGCCGTCGTTGGTTCGTTCTTGCTGCTCTCCTTTGTG
GTTACGGAAACTTATGCCGGTAATAGGCCTTCTGGTCGCTTTCCCTTACGGGGCTCTGTCTGACAAGTAAACTTG
TGTCCCCCTTGCTATCATGGGACGCCTTCGGCTGACAATGACATGGGCAGGGTCGGACGAAAGCCCATCATTCTG
CTGTCCATCACTGGCTTCACCCTCTCTTCGGCGTGGATAGCCCATATCCTAGCCCATCAAGAGACGTCGATTCAA
GCCATCCTCCTCGCCCCAGTCTTCTTCTTAATCGGCGGCGGCAGACACGTCACCTTCTCTACCCTCTTCTCAGCC
GTCTCCGATGTGACGACGCATGAAAACCGGCACGTCATCACCCCTTCCATGTCTGAACATTCAGGGGCTAACCAA
CGTATAAAGGGCCTCGGCCTTTGTCACAATCTCGCTTGGAAGCTTCATGGGAGGAGTCATCGGGCCCGTAGTCTC
ATCAGGTCTCATGCAGGTCGCCAGCCCATGGCTCCCGTTTCTACTGAGCTTTGGCATGGGACTCATCGGAGCAAT
CATACTGCTGCTCGTGCCCGAGACTCTCCCCCTCGACAAACACGAGCAAGACGACGACCCCGTCCATGACAAGAC
GGCCGTCCTTCCCGGCCACCACCTCTCCCTTCTCAGAGCCTCACTGAGCATGCTTTGGCATCCCAAACTGGCCCT
CATCCTCGTCACCTTCCTGGCCCCGATGCCCATGTCAACGGCAGCAAACCAGTTCCTCGTCCAGTACATCAGCAA
GCGCTTCGGCTGGTCCATGGCCGACGCCGGCTACCTGCAGTCAATCCGCGGAGCCATCAACGTCTTCCTCCTACT
CGCCATCCTCCCTTTCCTGAGCCGCCTGCTCAAAGACCGAACCCTAGCCCGACTATCAGCCCTCGCCATGACCCT
CGGCTGCCTCCTCATGGCCGGCTCCAGCATGCCGCTGCTGGTAACCGGCCTCATCATCAACACGCTGGGCAACGG
CCTGGCCCCCCTTTGCCGCTCCCTGGCAGCCAGCCTCGTCGCCCACCACGAGCAGGCCAGGCTACAGACGCTGAT
TGCCATGGTCGAGGCCTCGGGCTCGCTGCTCGCGGGTCCGACCCTTGCTGCTGCGCTGTCGACTGGCATGCGTAT
GGGCGGCGACTGGATGGGGATTCCGTACTTTGCTCTGGCCATCTTCTTATTCCTCACTACTTTCCCCTTGTTCTT
GTTATCGAGGCTAGGGGAAACGATCGAGGCCAAGGATCACCATGACCAAGACGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail