Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|627
Gene name
LocationContig_12:34140..35879
Strand+
Gene length (bp)1739
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1 464 2.0E-18
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 196 468 4.0E-14
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 19 468 4.0E-13
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 160 370 9.0E-11
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 159 458 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1 464 2.0E-18
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 196 468 4.0E-14
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 19 468 4.0E-13
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 160 370 9.0E-11
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 159 458 8.0E-10
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 9 453 2.0E-09
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 160 473 2.0E-09
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 186 456 4.0E-09
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 176 457 4.0E-09
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 169 457 1.0E-08
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 186 463 5.0E-08
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 165 465 7.0E-08
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 187 456 6.0E-07
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 187 456 6.0E-07
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 185 469 1.0E-06
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 196 473 2.0E-06
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 185 473 6.0E-06
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 164 458 8.0E-06
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 187 473 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 60 82 22
3 92 111 19
4 124 143 19
5 147 169 22
6 258 280 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|627
MNTTADASFGPRLPDRFDFTLSFEQVVFSIGPSAVLLLASPLRIATLARRKPTFRSDALLWFKMICILLLFGLRL
AELALWIVSSPSLRTRTTLAAASLSLAVVVALGSLLYAEHRYSHSPSTLISLYLSVTILLDIASIRSLFLRGGLF
AFAIVSVAALVVKLLLLAFEEVPKRELSAPVTSKETSSGLWNRSVFWWLNSTLYRGYTAFLGVDDLPSLDHKLDS
HRLVSSLNHEWRSIEKPAQHSLAYATFAAFKATFWAAVIPRLCFTAFTFAQPFLINTVVQFLGAPRSDDSRGSQH
PQVSKCHYMHHTFRLITSVRGGLVALIFAKVVDLEATTAKDTAALTLMSTDIDGISSGLQDVHDMWASFIELGLG
VFLLQRQVGAACFLVLVPAVLSSIATARVAQGMGPAKALWNSNVQKRVSTTSSALGQIKGIKMMGIEDRISRLIQ
SLRVFELDSSKSFRLFSVWINMIGASCCLDQYTLYSGC*
Coding >Ophun1|627
ATGAACACGACAGCAGACGCCTCCTTCGGCCCACGGCTGCCGGACCGCTTCGACTTCACCCTCTCGTTCGAGCAA
GTCGTCTTCTCCATCGGCCCATCTGCTGTGCTGTTACTTGCCTCACCGCTTCGAATTGCGACTCTGGCCCGAAGA
AAGCCGACTTTCAGGTCCGATGCCTTGCTCTGGTTCAAGATGATTTGTATCCTTCTCCTATTCGGTCTTCGACTG
GCTGAACTGGCGCTATGGATTGTCTCCTCACCGTCTTTACGTACTCGAACTACGTTGGCCGCTGCCAGCCTCTCG
CTCGCCGTTGTCGTGGCCTTGGGATCACTTCTTTATGCTGAGCATCGCTACTCTCACTCGCCCTCCACACTGATT
AGTCTGTACTTGTCGGTCACGATTCTGCTTGACATTGCCAGCATTCGCTCCCTCTTTCTTCGCGGCGGTTTGTTT
GCGTTTGCCATCGTTAGCGTTGCTGCTCTCGTTGTCAAGCTTCTGCTGCTCGCATTCGAAGAGGTCCCTAAGCGG
GAGCTCTCTGCACCCGTAACGTCCAAGGAGACTTCGAGCGGACTTTGGAATCGCTCCGTCTTTTGGTGGCTGAAT
TCGACGCTTTACAGGGGCTACACTGCCTTCCTTGGAGTCGATGATTTGCCCAGCCTCGATCACAAGCTAGACTCT
CACCGGCTTGTCTCTAGCTTGAACCACGAATGGAGATCGATTGAGAAACCTGCTCAGCACTCTCTGGCTTATGCC
ACTTTTGCTGCGTTCAAGGCAACCTTCTGGGCTGCGGTGATCCCTAGGCTCTGCTTCACAGCCTTTACCTTTGCT
CAGCCCTTTCTGATCAACACGGTGGTCCAATTTCTCGGGGCTCCGCGCTCGGACGACTCCCGGGGCTCGCAGCAT
CCGCAGGTCTCAAAGTGTCACTACATGCATCACACGTTCCGTCTCATCACCTCCGTGCGAGGCGGTCTTGTGGCG
CTCATCTTTGCCAAAGTCGTGGACCTAGAGGCAACTACGGCCAAAGATACTGCTGCTTTGACCCTGATGAGCACT
GACATCGACGGAATCTCCAGCGGACTTCAGGACGTTCACGATATGTGGGCGAGCTTCATCGAGCTGGGTCTCGGC
GTCTTTCTGCTTCAGCGGCAAGTCGGGGCGGCCTGCTTCCTGGTTCTGGTTCCTGCTGTTCTGTCAAGCATAGCA
ACTGCTCGAGTGGCTCAAGGCATGGGTCCGGCTAAAGCGTTGTGGAATTCCAATGTGCAGAAGCGAGTCTCGACA
ACCTCGTCGGCTCTCGGTCAAATCAAAGGCATCAAGATGATGGGCATCGAAGACCGCATCTCCCGCCTCATCCAG
TCTCTCCGCGTCTTCGAACTTGATTCGTCCAAGAGCTTCCGTCTCTTCTCTGTGTGGATCAACATGATAGGTGCT
TCTTGCTGCCTCGACCAGTACACTCTTTACTCGGGTTGCTGA
Transcript >Ophun1|627
ATGAACACGACAGCAGACGCCTCCTTCGGCCCACGGCTGCCGGACCGCTTCGACTTCACCCTCTCGTTCGAGCAA
GTCGTCTTCTCCATCGGCCCATCTGCTGTGCTGTTACTTGCCTCACCGCTTCGAATTGCGACTCTGGCCCGAAGA
AAGCCGACTTTCAGGTCCGATGCCTTGCTCTGGTTCAAGATGATTTGTATCCTTCTCCTATTCGGTCTTCGACTG
GCTGAACTGGCGCTATGGATTGTCTCCTCACCGTCTTTACGTACTCGAACTACGTTGGCCGCTGCCAGCCTCTCG
CTCGCCGTTGTCGTGGCCTTGGGATCACTTCTTTATGCTGAGCATCGCTACTCTCACTCGCCCTCCACACTGATT
AGTCTGTACTTGTCGGTCACGATTCTGCTTGACATTGCCAGCATTCGCTCCCTCTTTCTTCGCGGCGGTTTGTTT
GCGTTTGCCATCGTTAGCGTTGCTGCTCTCGTTGTCAAGCTTCTGCTGCTCGCATTCGAAGAGGTCCCTAAGCGG
GAGCTCTCTGCACCCGTAACGTCCAAGGAGACTTCGAGCGGACTTTGGAATCGCTCCGTCTTTTGGTGGCTGAAT
TCGACGCTTTACAGGGGCTACACTGCCTTCCTTGGAGTCGATGATTTGCCCAGCCTCGATCACAAGCTAGACTCT
CACCGGCTTGTCTCTAGCTTGAACCACGAATGGAGATCGATTGAGAAACCTGCTCAGCACTCTCTGGCTTATGCC
ACTTTTGCTGCGTTCAAGGCAACCTTCTGGGCTGCGGTGATCCCTAGGCTCTGCTTCACAGCCTTTACCTTTGCT
CAGCCCTTTCTGATCAACACGGTGGTCCAATTTCTCGGGGCTCCGCGCTCGGACGACTCCCGGGGCTCGCAGCAT
CCGCAGGTCTCAAAGTGTCACTACATGCATCACACGTTCCGTCTCATCACCTCCGTGCGAGGCGGTCTTGTGGCG
CTCATCTTTGCCAAAGTCGTGGACCTAGAGGCAACTACGGCCAAAGATACTGCTGCTTTGACCCTGATGAGCACT
GACATCGACGGAATCTCCAGCGGACTTCAGGACGTTCACGATATGTGGGCGAGCTTCATCGAGCTGGGTCTCGGC
GTCTTTCTGCTTCAGCGGCAAGTCGGGGCGGCCTGCTTCCTGGTTCTGGTTCCTGCTGTTCTGTCAAGCATAGCA
ACTGCTCGAGTGGCTCAAGGCATGGGTCCGGCTAAAGCGTTGTGGAATTCCAATGTGCAGAAGCGAGTCTCGACA
ACCTCGTCGGCTCTCGGTCAAATCAAAGGCATCAAGATGATGGGCATCGAAGACCGCATCTCCCGCCTCATCCAG
TCTCTCCGCGTCTTCGAACTTGATTCGTCCAAGAGCTTCCGTCTCTTCTCTGTGTGGATCAACATGATAGGTGCT
TCTTGCTGCCTCGACCAGTACACTCTTTACTCGGGTTGCTGA
Gene >Ophun1|627
ATGAACACGACAGCAGACGCCTCCTTCGGCCCACGGCTGCCGGACCGCTTCGACTTCACCCTCTCGTTCGAGCAA
GTCGTCTTCTCCATCGGCCCATCTGCTGTGCTGTTACTTGCCTCACCGCTTCGAATTGCGACTCTGGCCCGAAGA
AAGCCGACTTTCAGGTCCGATGCCTTGCTCTGGTTCAAGATGGTGGGCGACTCCGTCTGCTTCTCGACGACGGGC
TGACTTTTGGATAGATTTGTATCCTTCTCCTATTCGGTCTTCGACTGGCTGAACTGGCGCTATGGATTGTCTCCT
CACCGTCTTTACGTACTCGAACTACGTTGGCCGCTGCCAGCCTCTCGCTCGCCGTTGTCGTGGCCTTGGGATCAC
TTCTTTATGCTGAGCATCGCTACTCTCACTCGCCCTCCACACTGATTAGTCTGTACTTGTCGGTCACGATTCTGC
TTGACATTGCCAGCATTCGCTCCCTCTTTCTTCGCGGCGGTTTGTTTGCGTTTGCCATCGTTAGCGTTGCTGCTC
TCGTTGTCAAGCTTCTGCTGCTCGCATTCGAAGAGGTCCCTAAGCGGGAGCTCTCTGCACCCGTAACGTCCAAGG
AGACTTCGAGCGGACTTTGGAATCGCTCCGTCTTTTGGTGGCTGAATTCGACGCTTTACAGGGGCTACACTGCCT
TCCTTGGAGTCGATGATTTGCCCAGCCTCGATCACAAGCTAGACTCTCACCGGCTTGTCTCTAGCTTGAACCACG
AATGGAGATCGAGTAGGTTGGCAGCGGCTTCAGTATCAATCAGTCTTCGTCGTCTATTTTGCTGAGTTCGAGCCA
GTTGAGAAACCTGCTCAGCACTCTCTGGCTTATGCCACTTTTGCTGCGTTCAAGGCAACCTTCTGGGCTGCGGTG
ATCCCTAGGCTCTGCTTCACAGCCTTTACCTTTGCTCAGCCCTTTCTGATCAACACGGTGGTCCAATTTCTCGGG
GCTCCGCGCTCGGACGACTCCCGGGGCGTAATTGGGGGCCTCGTTGCCGCTGCAGCTTTGGTATATCTTGGGGTA
GCGGTATGTCACCTTTCGATGGGGCTTCATCGTCTTCATCCACTTAGTCGCAGCATCCGCAGGTCTCAAAGTGTC
ACTACATGCATCACACGTTCCGTCTCATCACCTCCGTGCGAGGCGGTCTTGTGGCGCTCATCTTTGCCAAAGTCG
TGGACCTAGAGGCAACTACGGCCAAAGATACTGCTGCTTTGACCCTGATGAGCACTGACATCGACGGAATCTCCA
GCGGACTTCAGGACGTTCACGATATGTGGGCGAGCTTCATCGAGCTGGGTCTCGGCGTCTTTCTGCTTCAGCGGC
AAGTCGGGGCGGCCTGCTTCCTGGTTCTGGTTCCTGCTGTTCGTGAGTCTTGGCTTGCTTCTCATCGCGGCTCTG
GGCTTTACCCCTGACGACGGTGACGGTGTGTAGTGTCAAGCATAGCAACTGCTCGAGTGGCTCAAGGCATGGGTC
CGGCTAAAGCGTTGTGGAATTCCAATGTGCAGAAGCGAGTCTCGACAACCTCGTCGGCTCTCGGTCAAATCAAAG
GCATCAAGATGATGGGCATCGAAGACCGCATCTCCCGCCTCATCCAGTCTCTCCGCGTCTTCGAACTTGATTCGT
CCAAGAGCTTCCGTCTCTTCTCTGTGTGGATCAACATGATAGGTGCTTCTTGCTGCCTCGACCAGTACACTCTTT
ACTCGGGTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail