Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|626
Gene name
LocationContig_12:31089..33357
Strand+
Gene length (bp)2268
Transcript length (bp)2268
Coding sequence length (bp)2268
Protein length (aa) 756

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.4E-42 166 477
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.1E-30 169 477

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 149 478 4.0E-54
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 151 475 5.0E-46
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 151 501 2.0E-21
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 214 497 2.0E-20
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 159 477 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 149 478 4.0E-54
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 151 475 5.0E-46
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 151 501 2.0E-21
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 214 497 2.0E-20
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 159 477 4.0E-20
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 146 476 2.0E-19
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 171 476 2.0E-19
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 171 477 5.0E-19
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 151 479 8.0E-19
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 170 476 2.0E-18
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 151 475 2.0E-18
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 170 476 5.0E-18
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 170 476 6.0E-18
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 146 477 8.0E-18
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 161 404 9.0E-18
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 171 477 1.0E-17
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 191 414 1.0E-17
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 171 414 2.0E-17
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 165 475 3.0E-17
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 171 476 6.0E-17
sp|Q61UC4|KRAF1_CAEBR Raf homolog serine/threonine-protein kinase OS=Caenorhabditis briggsae GN=lin-45 PE=3 SV=2 165 494 1.0E-16
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 170 477 1.0E-16
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 150 475 1.0E-16
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 161 420 1.0E-16
sp|Q07292|KRAF1_CAEEL Raf homolog serine/threonine-protein kinase OS=Caenorhabditis elegans GN=lin-45 PE=1 SV=2 165 494 1.0E-16
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 170 476 2.0E-16
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 165 480 2.0E-16
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 175 477 2.0E-16
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 146 521 3.0E-16
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 150 469 4.0E-16
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 170 476 4.0E-16
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 171 476 5.0E-16
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 171 479 5.0E-16
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 170 476 5.0E-16
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 170 476 5.0E-16
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 165 476 6.0E-16
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 205 476 6.0E-16
sp|G5ECJ6|CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans GN=csk-1 PE=1 SV=1 185 484 6.0E-16
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 161 477 6.0E-16
sp|Q80ZW0|STK35_MOUSE Serine/threonine-protein kinase 35 OS=Mus musculus GN=Stk35 PE=1 SV=3 250 483 7.0E-16
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 315 477 7.0E-16
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 171 477 7.0E-16
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 171 478 1.0E-15
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 171 476 1.0E-15
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 150 469 1.0E-15
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 106 469 1.0E-15
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 170 478 1.0E-15
sp|Q8TDR2|STK35_HUMAN Serine/threonine-protein kinase 35 OS=Homo sapiens GN=STK35 PE=1 SV=2 209 483 1.0E-15
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 170 476 1.0E-15
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 170 476 2.0E-15
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 170 523 2.0E-15
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 170 476 2.0E-15
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 162 476 2.0E-15
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 313 476 2.0E-15
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 171 476 2.0E-15
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 146 521 2.0E-15
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 146 521 2.0E-15
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 170 502 2.0E-15
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 170 476 2.0E-15
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 165 476 2.0E-15
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 170 519 3.0E-15
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 170 476 3.0E-15
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 171 476 3.0E-15
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 170 476 3.0E-15
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 161 477 3.0E-15
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 170 476 3.0E-15
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 106 591 4.0E-15
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 164 476 4.0E-15
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 161 477 5.0E-15
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 175 490 6.0E-15
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 168 617 6.0E-15
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 171 476 6.0E-15
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 171 476 7.0E-15
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 159 475 7.0E-15
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 159 475 7.0E-15
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 139 476 8.0E-15
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 159 475 8.0E-15
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 139 476 9.0E-15
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 165 473 9.0E-15
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 171 475 9.0E-15
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 171 476 1.0E-14
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 302 476 1.0E-14
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 165 476 1.0E-14
sp|Q9QY78|IKKB_RAT Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Rattus norvegicus GN=Ikbkb PE=1 SV=1 171 414 1.0E-14
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 168 617 1.0E-14
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 171 477 1.0E-14
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 111 411 1.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 170 416 2.0E-14
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 206 476 2.0E-14
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 209 476 2.0E-14
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 161 477 2.0E-14
sp|P0C1X8|AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus GN=Aak1 PE=1 SV=1 168 617 2.0E-14
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 295 476 2.0E-14
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 208 477 2.0E-14
sp|P10447|ABL_FSVHY Tyrosine-protein kinase transforming protein Abl OS=Feline sarcoma virus (strain Hardy-Zuckerman 2) GN=ABL PE=2 SV=1 208 475 2.0E-14
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 165 475 2.0E-14
sp|O14920|IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens GN=IKBKB PE=1 SV=1 171 414 3.0E-14
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 170 477 3.0E-14
sp|P09769|FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens GN=FGR PE=1 SV=2 318 471 3.0E-14
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 170 526 3.0E-14
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 162 476 3.0E-14
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 170 504 3.0E-14
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 136 477 3.0E-14
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 170 526 4.0E-14
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 168 418 4.0E-14
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 307 476 4.0E-14
sp|Q95KV0|IKKB_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Bos taurus GN=IKBKB PE=2 SV=1 171 414 4.0E-14
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 171 522 4.0E-14
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 170 500 4.0E-14
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 165 418 4.0E-14
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 171 414 4.0E-14
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 170 526 5.0E-14
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 168 418 5.0E-14
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 313 477 5.0E-14
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 170 486 5.0E-14
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 165 477 5.0E-14
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 302 476 5.0E-14
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 170 476 5.0E-14
sp|O88351|IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus GN=Ikbkb PE=1 SV=1 171 414 6.0E-14
sp|Q3UHJ0|AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus GN=Aak1 PE=1 SV=2 168 414 6.0E-14
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 170 476 6.0E-14
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 145 418 6.0E-14
sp|P00532|RAF_MSV36 Serine/threonine-protein kinase-transforming protein raf OS=Murine sarcoma virus 3611 GN=V-RAF PE=3 SV=1 313 496 6.0E-14
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 170 471 7.0E-14
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 164 475 7.0E-14
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 171 522 7.0E-14
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 168 418 7.0E-14
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 168 476 7.0E-14
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 176 478 7.0E-14
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 314 480 8.0E-14
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 170 526 8.0E-14
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 295 476 1.0E-13
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 171 476 1.0E-13
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 171 476 1.0E-13
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 171 475 1.0E-13
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 214 492 1.0E-13
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 315 477 1.0E-13
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 171 485 1.0E-13
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 214 479 1.0E-13
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 171 414 1.0E-13
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 162 478 1.0E-13
sp|Q95KV1|IKKA_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Bos taurus GN=CHUK PE=1 SV=1 171 414 1.0E-13
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 168 414 1.0E-13
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 165 478 1.0E-13
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 169 473 2.0E-13
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 170 526 2.0E-13
sp|O15111|IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens GN=CHUK PE=1 SV=2 171 414 2.0E-13
sp|P54754|EPHB3_MOUSE Ephrin type-B receptor 3 OS=Mus musculus GN=Ephb3 PE=1 SV=2 168 502 2.0E-13
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 163 478 2.0E-13
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 171 428 2.0E-13
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 168 493 2.0E-13
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 170 526 2.0E-13
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 165 475 2.0E-13
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 168 418 2.0E-13
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 165 418 2.0E-13
sp|Q6NU47|PDK1A_XENLA Serine/threonine-protein kinase pdik1l-A OS=Xenopus laevis GN=pdik1-a PE=2 SV=1 242 475 2.0E-13
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 170 526 2.0E-13
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 295 476 2.0E-13
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 164 475 2.0E-13
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 171 476 2.0E-13
sp|P42683|LCK_CHICK Proto-oncogene tyrosine-protein kinase LCK OS=Gallus gallus GN=LCK PE=2 SV=2 301 471 2.0E-13
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 165 491 2.0E-13
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 209 489 2.0E-13
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 242 475 2.0E-13
sp|P31152|MK04_HUMAN Mitogen-activated protein kinase 4 OS=Homo sapiens GN=MAPK4 PE=1 SV=2 165 472 2.0E-13
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 165 491 2.0E-13
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 170 485 2.0E-13
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 164 475 2.0E-13
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 172 475 3.0E-13
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 151 477 3.0E-13
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 214 476 3.0E-13
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 171 476 3.0E-13
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 171 476 3.0E-13
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 168 418 3.0E-13
sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 GN=V-RMIL PE=3 SV=1 301 522 3.0E-13
sp|P08103|HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus GN=Hck PE=1 SV=4 308 479 3.0E-13
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 303 508 3.0E-13
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 162 507 3.0E-13
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 170 418 4.0E-13
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 168 418 4.0E-13
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 171 477 4.0E-13
sp|P50545|HCK_RAT Tyrosine-protein kinase HCK OS=Rattus norvegicus GN=Hck PE=1 SV=4 308 479 4.0E-13
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 159 421 4.0E-13
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 214 421 4.0E-13
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 170 487 4.0E-13
sp|P06239|LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens GN=LCK PE=1 SV=6 301 480 4.0E-13
sp|Q9Z139|ROR1_MOUSE Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Mus musculus GN=Ror1 PE=2 SV=2 214 525 5.0E-13
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 171 476 5.0E-13
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 170 476 5.0E-13
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 170 538 5.0E-13
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 306 476 5.0E-13
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 136 477 5.0E-13
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 170 476 5.0E-13
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 171 475 6.0E-13
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 144 480 6.0E-13
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 170 418 6.0E-13
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 171 476 6.0E-13
sp|Q01973|ROR1_HUMAN Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens GN=ROR1 PE=1 SV=2 214 525 7.0E-13
sp|Q6P6U0|FGR_RAT Tyrosine-protein kinase Fgr OS=Rattus norvegicus GN=Fgr PE=1 SV=1 318 471 7.0E-13
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 165 421 7.0E-13
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 153 418 8.0E-13
sp|P42690|SRK4_SPOLA Tyrosine-protein kinase isoform SRK4 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 303 471 8.0E-13
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 159 421 8.0E-13
sp|Q9Z335|SBK1_RAT Serine/threonine-protein kinase SBK1 OS=Rattus norvegicus GN=Sbk1 PE=1 SV=1 171 482 8.0E-13
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 168 421 8.0E-13
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 171 484 8.0E-13
sp|Q9CAL8|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13 OS=Arabidopsis thaliana GN=PERK13 PE=2 SV=1 165 499 9.0E-13
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 171 482 9.0E-13
sp|P10533|RMIL_AVII1 Serine/threonine-protein kinase-transforming protein Rmil OS=Avian retrovirus IC10 GN=V-RMIL PE=3 SV=1 301 518 9.0E-13
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 171 519 1.0E-12
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 164 475 1.0E-12
sp|Q54R58|YTYK2_DICDI Probable tyrosine-protein kinase DDB_G0283397 OS=Dictyostelium discoideum GN=DDB_G0283397 PE=3 SV=1 214 480 1.0E-12
sp|P00541|FPS_AVISP Tyrosine-protein kinase transforming protein Fps OS=Avian sarcoma virus (strain PRCII) GN=V-FPS PE=3 SV=1 171 475 1.0E-12
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 157 477 1.0E-12
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 171 420 1.0E-12
sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens GN=BRAF PE=1 SV=4 313 522 1.0E-12
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 214 477 1.0E-12
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 171 469 1.0E-12
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 295 476 1.0E-12
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 170 526 1.0E-12
sp|P28028|BRAF_MOUSE Serine/threonine-protein kinase B-raf OS=Mus musculus GN=Braf PE=1 SV=3 313 522 1.0E-12
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 170 420 1.0E-12
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 159 475 1.0E-12
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 165 477 1.0E-12
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 159 475 1.0E-12
sp|P08631|HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens GN=HCK PE=1 SV=5 308 479 1.0E-12
sp|Q04982|BRAF_CHICK Serine/threonine-protein kinase B-raf OS=Gallus gallus GN=BRAF PE=1 SV=1 313 525 1.0E-12
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 164 475 1.0E-12
sp|Q54H05|KINY_DICDI Probable serine/threonine-protein kinase kinY OS=Dictyostelium discoideum GN=kinY PE=2 SV=1 214 511 1.0E-12
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 311 475 1.0E-12
sp|Q05688|IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus GN=IGF1R PE=2 SV=1 314 486 1.0E-12
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 206 476 1.0E-12
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 170 418 1.0E-12
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 214 477 1.0E-12
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 161 420 1.0E-12
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 171 476 1.0E-12
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 168 476 1.0E-12
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 67 476 1.0E-12
sp|P34908|BRAF_COTJA Serine/threonine-protein kinase B-raf OS=Coturnix coturnix japonica GN=BRAF PE=2 SV=1 313 522 2.0E-12
sp|Q8QZR7|PDK1L_MOUSE Serine/threonine-protein kinase PDIK1L OS=Mus musculus GN=Pdik1l PE=2 SV=1 250 475 2.0E-12
sp|P00530|FPS_FUJSV Tyrosine-protein kinase transforming protein Fps OS=Fujinami sarcoma virus GN=V-FPS PE=3 SV=1 171 475 2.0E-12
sp|Q60680|IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus GN=Chuk PE=1 SV=1 171 414 2.0E-12
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 161 420 2.0E-12
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 161 420 2.0E-12
sp|P47355|PKNS_MYCGE Putative serine/threonine-protein kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG109 PE=3 SV=2 168 431 2.0E-12
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 310 476 2.0E-12
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 313 495 2.0E-12
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 214 477 2.0E-12
sp|Q95KR7|LCK_SAISC Proto-oncogene tyrosine-protein kinase LCK OS=Saimiri sciureus GN=LCK PE=1 SV=3 301 480 2.0E-12
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 159 476 2.0E-12
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 171 477 2.0E-12
sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus GN=Tec PE=1 SV=2 296 486 2.0E-12
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 171 519 2.0E-12
sp|Q99N57|RAF1_MOUSE RAF proto-oncogene serine/threonine-protein kinase OS=Mus musculus GN=Raf1 PE=1 SV=2 313 495 2.0E-12
sp|Q07494|EPHB1_CHICK Ephrin type-B receptor 1 (Fragment) OS=Gallus gallus GN=EPHB1 PE=2 SV=2 121 479 2.0E-12
sp|Q07497|EPHB5_CHICK Ephrin type-B receptor 5 OS=Gallus gallus GN=EPHB5 PE=2 SV=1 81 479 2.0E-12
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 223 476 2.0E-12
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 171 428 2.0E-12
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 171 428 2.0E-12
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 303 500 2.0E-12
sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus GN=Txk PE=1 SV=1 298 479 2.0E-12
sp|Q07014|LYN_RAT Tyrosine-protein kinase Lyn OS=Rattus norvegicus GN=Lyn PE=1 SV=3 308 479 2.0E-12
sp|Q2H6X2|ATG1_CHAGB Serine/threonine-protein kinase ATG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG1 PE=3 SV=1 165 471 2.0E-12
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 171 475 2.0E-12
sp|P11346|KRAF1_DROME Raf homolog serine/threonine-protein kinase phl OS=Drosophila melanogaster GN=phl PE=1 SV=6 313 514 2.0E-12
sp|O73798|IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis GN=igf1r PE=1 SV=1 274 486 2.0E-12
sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus GN=Lyn PE=1 SV=4 308 479 3.0E-12
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 297 477 3.0E-12
sp|Q8N165|PDK1L_HUMAN Serine/threonine-protein kinase PDIK1L OS=Homo sapiens GN=PDIK1L PE=1 SV=1 250 475 3.0E-12
sp|P14234|FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus GN=Fgr PE=1 SV=2 318 471 3.0E-12
sp|Q1KL86|EPHA2_MACFA Ephrin type-A receptor 2 OS=Macaca fascicularis GN=EPHA2 PE=2 SV=1 302 479 3.0E-12
sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus GN=Ephb1 PE=1 SV=1 163 479 3.0E-12
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 208 418 3.0E-12
sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus GN=Ephb1 PE=1 SV=2 163 479 3.0E-12
sp|P29317|EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens GN=EPHA2 PE=1 SV=2 302 479 3.0E-12
sp|Q91Z96|BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus GN=Bmp2k PE=1 SV=1 168 414 3.0E-12
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 205 421 3.0E-12
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 208 469 3.0E-12
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 206 421 3.0E-12
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 191 476 3.0E-12
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 176 476 3.0E-12
sp|Q6EWH2|FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio GN=fyna PE=1 SV=2 315 471 3.0E-12
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 165 422 3.0E-12
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 158 493 3.0E-12
sp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 15 OS=Oryza sativa subsp. japonica GN=MPK15 PE=2 SV=1 168 493 3.0E-12
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 308 479 3.0E-12
sp|Q8TFN2|ATG1_PICAN Serine/threonine-protein kinase ATG1 OS=Pichia angusta GN=ATG1 PE=3 SV=1 204 469 3.0E-12
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 170 532 3.0E-12
sp|P27446|FYN_XIPHE Tyrosine-protein kinase Fyn OS=Xiphophorus helleri GN=fyn PE=2 SV=3 315 471 3.0E-12
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 194 471 4.0E-12
sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens GN=EPHB1 PE=1 SV=1 163 479 4.0E-12
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 171 420 4.0E-12
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 214 444 4.0E-12
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 170 414 4.0E-12
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 310 476 4.0E-12
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 206 476 4.0E-12
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 208 469 4.0E-12
sp|Q93V58|GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana GN=GRIK1 PE=1 SV=1 152 475 4.0E-12
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 170 416 4.0E-12
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 310 477 4.0E-12
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 136 477 4.0E-12
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 170 476 4.0E-12
sp|Q01621|LCK_RAT Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus GN=Lck PE=1 SV=3 301 471 5.0E-12
sp|Q5PXS1|LCK_AOTNA Tyrosine-protein kinase Lck OS=Aotus nancymaae GN=LCK PE=2 SV=4 301 480 5.0E-12
sp|Q96S53|TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens GN=TESK2 PE=1 SV=1 171 578 5.0E-12
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 153 476 5.0E-12
sp|Q32PP3|PDK1L_DANRE Serine/threonine-protein kinase pdik1l OS=Danio rerio GN=pdik1l PE=2 SV=1 208 475 5.0E-12
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 170 476 5.0E-12
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 165 422 5.0E-12
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 168 413 5.0E-12
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 309 541 5.0E-12
sp|Q9LSE1|CDG1_ARATH Serine/threonine-protein kinase CDG1 OS=Arabidopsis thaliana GN=CDG1 PE=1 SV=1 123 411 5.0E-12
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 171 516 5.0E-12
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 171 516 5.0E-12
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 170 526 5.0E-12
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 209 476 5.0E-12
sp|P11345|RAF1_RAT RAF proto-oncogene serine/threonine-protein kinase OS=Rattus norvegicus GN=Raf1 PE=1 SV=1 313 495 5.0E-12
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 209 476 6.0E-12
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 170 478 6.0E-12
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 144 578 6.0E-12
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 311 476 6.0E-12
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 171 475 6.0E-12
sp|P06240|LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus GN=Lck PE=1 SV=4 301 471 6.0E-12
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 170 526 6.0E-12
sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 168 414 6.0E-12
sp|Q24488|ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster GN=Ror PE=1 SV=1 214 481 7.0E-12
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 307 414 7.0E-12
sp|Q5RER6|PDK1L_PONAB Serine/threonine-protein kinase PDIK1L OS=Pongo abelii GN=PDIK1L PE=2 SV=2 250 475 7.0E-12
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 171 482 7.0E-12
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 170 414 7.0E-12
sp|P14617|INSRR_CAVPO Insulin receptor-related protein OS=Cavia porcellus GN=INSRR PE=3 SV=1 274 482 8.0E-12
sp|P54936|LIN2_CAEEL Protein lin-2 OS=Caenorhabditis elegans GN=lin-2 PE=1 SV=1 208 477 8.0E-12
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 168 493 8.0E-12
sp|Q8SQW2|CTK1_ENCCU Probable CTD kinase subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CTK1 PE=3 SV=1 170 476 8.0E-12
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 206 476 8.0E-12
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 168 420 8.0E-12
sp|F1RDG9|FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio GN=fynb PE=2 SV=1 318 471 8.0E-12
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 164 476 8.0E-12
sp|Q55CZ1|GDT2_DICDI Probable serine/threonine-protein kinase gdt2 OS=Dictyostelium discoideum GN=gdt2 PE=2 SV=1 204 480 8.0E-12
sp|P54753|EPHB3_HUMAN Ephrin type-B receptor 3 OS=Homo sapiens GN=EPHB3 PE=1 SV=2 168 502 9.0E-12
sp|Q63604|NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus GN=Ntrk2 PE=1 SV=1 214 481 9.0E-12
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 307 483 9.0E-12
sp|A7E3S4|RAF1_BOVIN RAF proto-oncogene serine/threonine-protein kinase OS=Bos taurus GN=RAF1 PE=2 SV=1 313 495 9.0E-12
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 170 418 9.0E-12
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 67 476 9.0E-12
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 156 476 9.0E-12
sp|Q6P5G0|MK04_MOUSE Mitogen-activated protein kinase 4 OS=Mus musculus GN=Mapk4 PE=1 SV=1 165 472 1.0E-11
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 170 418 1.0E-11
sp|Q62844|FYN_RAT Tyrosine-protein kinase Fyn OS=Rattus norvegicus GN=Fyn PE=1 SV=1 209 471 1.0E-11
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 171 416 1.0E-11
sp|A1Y2K1|FYN_PIG Tyrosine-protein kinase Fyn OS=Sus scrofa GN=FYN PE=2 SV=2 209 471 1.0E-11
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 211 476 1.0E-11
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 206 476 1.0E-11
sp|P06241|FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 209 471 1.0E-11
sp|P15209|NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus GN=Ntrk2 PE=1 SV=1 214 481 1.0E-11
sp|P39688|FYN_MOUSE Tyrosine-protein kinase Fyn OS=Mus musculus GN=Fyn PE=1 SV=4 315 471 1.0E-11
sp|P08069|IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens GN=IGF1R PE=1 SV=1 314 482 1.0E-11
sp|Q05876|FYN_CHICK Tyrosine-protein kinase Fyn OS=Gallus gallus GN=FYN PE=1 SV=2 315 471 1.0E-11
sp|Q91736|EPB1B_XENLA Ephrin type-B receptor 1-B (Fragment) OS=Xenopus laevis GN=ephb1-b PE=1 SV=1 99 479 1.0E-11
sp|P30530|UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens GN=AXL PE=1 SV=3 208 475 1.0E-11
sp|A0JNB0|FYN_BOVIN Tyrosine-protein kinase Fyn OS=Bos taurus GN=FYN PE=2 SV=1 209 471 1.0E-11
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 165 586 1.0E-11
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 165 586 1.0E-11
sp|P05625|RAF1_CHICK RAF proto-oncogene serine/threonine-protein kinase OS=Gallus gallus GN=RAF1 PE=2 SV=1 313 495 1.0E-11
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 165 418 1.0E-11
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 309 475 1.0E-11
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 192 421 1.0E-11
sp|P25848|PHY1_CERPU Light-sensor Protein kinase OS=Ceratodon purpureus GN=PHY1 PE=3 SV=3 214 480 1.0E-11
sp|Q13308|PTK7_HUMAN Inactive tyrosine-protein kinase 7 OS=Homo sapiens GN=PTK7 PE=1 SV=2 214 483 1.0E-11
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 165 476 1.0E-11
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 195 475 1.0E-11
sp|P13406|FYN_XENLA Tyrosine-protein kinase Fyn OS=Xenopus laevis GN=fyn PE=2 SV=3 315 471 1.0E-11
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 171 469 1.0E-11
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 208 414 1.0E-11
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 168 420 1.0E-11
sp|Q5R5M7|RAF1_PONAB RAF proto-oncogene serine/threonine-protein kinase OS=Pongo abelii GN=RAF1 PE=2 SV=1 313 495 1.0E-11
sp|P04049|RAF1_HUMAN RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens GN=RAF1 PE=1 SV=1 313 495 1.0E-11
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 165 477 1.0E-11
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 310 476 1.0E-11
sp|Q9Z138|ROR2_MOUSE Tyrosine-protein kinase transmembrane receptor ROR2 OS=Mus musculus GN=Ror2 PE=1 SV=2 209 500 1.0E-11
sp|Q03145|EPHA2_MOUSE Ephrin type-A receptor 2 OS=Mus musculus GN=Epha2 PE=1 SV=3 197 479 1.0E-11
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 206 476 1.0E-11
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 171 477 1.0E-11
sp|Q54QD5|NEK1_DICDI Probable serine/threonine-protein kinase nek1 OS=Dictyostelium discoideum GN=nek1 PE=3 SV=1 171 476 2.0E-11
sp|P00522|ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster GN=Abl PE=1 SV=3 180 480 2.0E-11
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 164 477 2.0E-11
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 171 482 2.0E-11
sp|Q60751|IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus GN=Igf1r PE=1 SV=3 314 482 2.0E-11
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 314 480 2.0E-11
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 170 418 2.0E-11
sp|Q16620|NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens GN=NTRK2 PE=1 SV=1 214 481 2.0E-11
sp|Q07498|EPHB3_CHICK Ephrin type-B receptor 3 (Fragment) OS=Gallus gallus GN=EPHB3 PE=2 SV=1 168 479 2.0E-11
sp|Q6GM53|IKKA_XENLA Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus laevis GN=chuk PE=2 SV=1 171 414 2.0E-11
sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform SRK1 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 303 471 2.0E-11
sp|P24062|IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus GN=Igf1r PE=2 SV=2 314 482 2.0E-11
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 171 475 2.0E-11
sp|P93050|RKF3_ARATH Probable LRR receptor-like serine/threonine-protein kinase RKF3 OS=Arabidopsis thaliana GN=RKF3 PE=2 SV=1 165 437 2.0E-11
sp|P09208|INSR_DROME Insulin-like receptor OS=Drosophila melanogaster GN=InR PE=1 SV=3 249 480 2.0E-11
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 306 476 2.0E-11
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 149 414 2.0E-11
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 170 480 2.0E-11
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 233 421 2.0E-11
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 314 479 2.0E-11
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 170 477 2.0E-11
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 315 481 2.0E-11
sp|Q9YI66|TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio GN=tyro3 PE=2 SV=1 208 480 2.0E-11
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 214 477 3.0E-11
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 209 475 3.0E-11
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 140 479 3.0E-11
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 67 476 3.0E-11
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 164 414 3.0E-11
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 206 421 3.0E-11
sp|Q95M30|HCK_MACFA Tyrosine-protein kinase HCK OS=Macaca fascicularis GN=HCK PE=2 SV=3 308 479 3.0E-11
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 171 475 3.0E-11
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 311 477 3.0E-11
sp|P09560|RAF1_XENLA RAF proto-oncogene serine/threonine-protein kinase OS=Xenopus laevis GN=raf1 PE=2 SV=1 313 495 3.0E-11
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 171 475 3.0E-11
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 315 471 3.0E-11
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 170 484 3.0E-11
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 208 479 3.0E-11
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 214 476 3.0E-11
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 171 480 3.0E-11
sp|P14616|INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens GN=INSRR PE=1 SV=2 274 482 3.0E-11
sp|Q8BKG3|PTK7_MOUSE Inactive tyrosine-protein kinase 7 OS=Mus musculus GN=Ptk7 PE=1 SV=1 214 479 3.0E-11
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 303 477 3.0E-11
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 165 505 3.0E-11
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 165 420 3.0E-11
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 206 421 3.0E-11
sp|Q06418|TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens GN=TYRO3 PE=1 SV=1 208 538 3.0E-11
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 171 476 3.0E-11
sp|Q9SYS7|CRK39_ARATH Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=3 SV=1 165 490 3.0E-11
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 164 474 3.0E-11
sp|P08923|LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus GN=Ltk PE=1 SV=3 212 484 4.0E-11
sp|P21709|EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens GN=EPHA1 PE=1 SV=4 302 470 4.0E-11
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 171 479 4.0E-11
sp|P51813|BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens GN=BMX PE=1 SV=1 171 480 4.0E-11
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 171 420 4.0E-11
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 194 477 4.0E-11
sp|P54755|EPHA5_CHICK Ephrin type-A receptor 5 OS=Gallus gallus GN=EPHA5 PE=2 SV=1 168 515 4.0E-11
sp|Q64716|INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus GN=Insrr PE=1 SV=3 274 482 4.0E-11
sp|P55144|TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus GN=Tyro3 PE=1 SV=2 208 471 4.0E-11
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 170 418 4.0E-11
sp|P55146|TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus norvegicus GN=Tyro3 PE=1 SV=1 208 471 4.0E-11
sp|Q62407|SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus GN=Speg PE=1 SV=2 165 476 4.0E-11
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 170 476 4.0E-11
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 206 476 4.0E-11
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 206 421 4.0E-11
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 67 426 4.0E-11
sp|A0JM20|TYRO3_XENTR Tyrosine-protein kinase receptor TYRO3 OS=Xenopus tropicalis GN=tyro3 PE=2 SV=1 208 471 4.0E-11
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 170 477 4.0E-11
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 171 476 4.0E-11
sp|P75524|PKNS_MYCPN Putative serine/threonine-protein kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_248 PE=3 SV=1 294 431 4.0E-11
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 171 476 5.0E-11
sp|P42681|TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens GN=TXK PE=1 SV=3 296 479 5.0E-11
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 171 475 5.0E-11
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 154 418 5.0E-11
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 162 418 5.0E-11
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 171 475 5.0E-11
sp|P42680|TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens GN=TEC PE=1 SV=2 296 415 5.0E-11
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 162 476 5.0E-11
sp|P54761|EPHB4_MOUSE Ephrin type-B receptor 4 OS=Mus musculus GN=Ephb4 PE=1 SV=2 136 479 5.0E-11
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 165 414 5.0E-11
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 205 485 6.0E-11
sp|E2RSS3|WEE2_CANLF Wee1-like protein kinase 2 OS=Canis lupus familiaris GN=WEE2 PE=3 SV=1 161 472 6.0E-11
sp|P97504|BMX_MOUSE Cytoplasmic tyrosine-protein kinase BMX OS=Mus musculus GN=Bmx PE=2 SV=1 314 480 6.0E-11
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 299 474 6.0E-11
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 221 420 6.0E-11
sp|P13116|SRC2_XENLA Tyrosine-protein kinase Src-2 OS=Xenopus laevis GN=src-b PE=2 SV=3 315 471 6.0E-11
sp|P21965|MCK1_YEAST Protein kinase MCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCK1 PE=1 SV=1 140 444 6.0E-11
sp|P54760|EPHB4_HUMAN Ephrin type-B receptor 4 OS=Homo sapiens GN=EPHB4 PE=1 SV=2 136 479 6.0E-11
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 165 493 6.0E-11
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 303 471 7.0E-11
sp|Q1LX51|WEE2_DANRE Wee1-like protein kinase 2 OS=Danio rerio GN=wee2 PE=2 SV=2 161 473 7.0E-11
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 308 476 7.0E-11
sp|P00527|YES_AVISY Tyrosine-protein kinase transforming protein Yes (Fragment) OS=Avian sarcoma virus (strain Y73) GN=V-YES PE=3 SV=2 315 471 7.0E-11
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 306 414 7.0E-11
sp|P13115|SRC1_XENLA Tyrosine-protein kinase Src-1 OS=Xenopus laevis GN=src-a PE=2 SV=4 315 471 7.0E-11
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 209 522 8.0E-11
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 131 404 8.0E-11
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 106 404 8.0E-11
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 206 476 8.0E-11
sp|P32593|MOS_MSVMT Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain ts110) GN=V-MOS PE=3 SV=1 302 416 8.0E-11
sp|P41239|CSK_CHICK Tyrosine-protein kinase CSK OS=Gallus gallus GN=CSK PE=2 SV=1 180 475 8.0E-11
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 308 482 8.0E-11
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 310 476 8.0E-11
sp|Q28DZ1|IKKA_XENTR Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus tropicalis GN=chuk PE=2 SV=1 171 414 9.0E-11
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 171 552 9.0E-11
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 170 472 9.0E-11
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 315 471 9.0E-11
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 221 420 9.0E-11
sp|P15054|SRC_AVIS2 Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain PR2257) GN=V-SRC PE=3 SV=3 295 471 9.0E-11
sp|P25020|SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) GN=V-SRC PE=1 SV=3 295 471 9.0E-11
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 165 477 9.0E-11
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 206 476 9.0E-11
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 170 472 9.0E-11
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 164 474 1.0E-10
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 194 416 1.0E-10
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 303 476 1.0E-10
sp|P00526|SRC_RSVP Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Prague C) GN=V-SRC PE=1 SV=3 295 471 1.0E-10
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 319 488 1.0E-10
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 315 476 7.0E-10
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 315 476 1.0E-09
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 319 476 2.0E-09
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 310 476 5.0E-09
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 315 476 3.0E-08
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 315 476 4.0E-08
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 315 476 5.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 315 476 5.0E-08
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 321 476 1.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 318 481 2.0E-06
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 319 414 2.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 319 476 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|626
MSLIPYHPREDGELVLFVASQQTDGEALKLTAPDSSRHQNSLVYRNPDSLRLEIYPRECPTCHQPLDRASSSEDR
HYDLDGEYVDPTYFRKLRAGTEATMPQEGVPSPVRRLFPALAGSGSGSGSEAQPVDSDTYFGDEADDSVSGAGSR
IRSEAFSPNYFKTFFVEETVLGRGGKGVVLLVRHEIDGCQLGHFACKRVPVGDDHGWLEKVLIEVELLAALSHPN
LVSYRHVWLENVQLTRFGPSVACAFILQQYCNGGDLHQYVVGGAPREATKEELKAQMRRRSKGQAEPPRDLAQGQ
LQLSFEDIYSFFRDITLGVAYLHTNNYIHRDLKPSNCLLHSEGGKLRCLISDFGEVQPKDTVRKSTGSTGTISYC
APEVLKMDVDGRYGNFTTKSDIFSLGMILYFMCFGRLPYQGANAIQEELEDMEQLRAEIADWEGFQDERRERPDL
PTRLYQLLKKLLALNPAERPSANEVLTAMKSETNFGGIPRVDRSSPTSASGPRRVQNLDSPAAPGTPVPGAGGEP
PSPSALSPRALADLVADARKERGWSRFADSWSEPDEGTDRAPSLERETASQSVAQPVVSQRRGHGLQPLAAEDGH
SRPLSASVSTPLLMAPPRSNMGEARYQMQMAAHRIVHTLRTERLLTSFATRLAFFLLKLGTLARPCWPLMASPQV
SIPLVVVAALDLVMSTADSPVAEQRRMRVSHGSLPPLDFFSTEAVTSLILLAVHFVGLWLARRWGSLCVAALPDD
DWAQW*
Coding >Ophun1|626
ATGTCGCTGATCCCGTACCATCCTCGCGAGGACGGTGAGCTCGTCCTGTTCGTCGCTTCGCAGCAGACTGATGGG
GAGGCGTTGAAACTGACTGCTCCTGACTCCAGCCGCCACCAAAACTCGCTCGTCTACCGAAACCCCGACTCCCTC
CGCCTCGAAATCTACCCTCGGGAATGCCCGACCTGTCACCAGCCGCTGGACCGCGCCTCGTCGTCCGAAGACCGG
CACTATGACTTGGACGGGGAATACGTCGATCCGACCTACTTTCGCAAGCTGCGCGCGGGCACAGAGGCTACGATG
CCGCAGGAGGGCGTGCCCAGCCCTGTTCGCAGGCTGTTTCCTGCACTAGCTGGCAGTGGCAGCGGCAGCGGTAGT
GAGGCACAGCCCGTCGACTCTGACACCTATTTTGGCGACGAAGCCGATGACTCGGTCTCGGGCGCGGGCAGCAGG
ATCCGGTCCGAGGCCTTTAGCCCCAACTACTTCAAGACCTTCTTCGTCGAAGAGACGGTTCTTGGCAGAGGCGGC
AAGGGCGTCGTCTTGCTCGTACGACACGAGATCGACGGTTGCCAGCTGGGTCACTTTGCCTGCAAACGCGTCCCC
GTCGGTGACGACCATGGCTGGCTGGAGAAGGTGTTGATCGAGGTCGAGCTCCTCGCCGCTCTATCGCACCCGAAC
CTCGTCTCGTATCGGCATGTGTGGCTCGAAAATGTCCAGCTCACCCGCTTTGGTCCCAGCGTGGCCTGTGCCTTT
ATCCTGCAGCAGTACTGTAACGGGGGCGACCTTCATCAGTACGTCGTGGGTGGCGCGCCCCGTGAGGCCACCAAG
GAGGAGCTCAAGGCCCAGATGCGCCGTCGTTCCAAGGGTCAGGCCGAGCCGCCTCGCGATCTCGCACAGGGCCAG
CTGCAGCTGTCGTTTGAAGACATCTACTCCTTCTTCAGAGATATCACGTTGGGGGTCGCCTACCTACACACCAAC
AACTACATACACCGCGATCTCAAGCCCAGCAACTGCCTGCTCCACAGCGAAGGCGGCAAGCTGAGGTGCCTCATC
AGCGACTTTGGAGAGGTGCAGCCGAAAGACACGGTTCGGAAGTCGACGGGATCGACAGGCACAATCTCGTACTGC
GCCCCGGAAGTGCTGAAGATGGACGTCGACGGGCGGTACGGAAACTTTACCACCAAGTCGGACATATTCTCCCTC
GGCATGATCCTCTACTTCATGTGCTTCGGTAGGCTGCCATACCAGGGAGCCAACGCCATCCAGGAAGAGCTCGAG
GATATGGAACAGCTCCGGGCCGAGATTGCCGACTGGGAGGGCTTCCAGGACGAGCGACGGGAGAGGCCCGACTTG
CCGACGCGCCTGTACCAGCTGCTAAAGAAGCTGCTGGCCCTAAACCCGGCAGAGCGGCCGAGCGCCAACGAGGTG
CTGACGGCCATGAAGAGCGAGACCAACTTTGGCGGCATCCCGAGGGTCGACAGATCGTCGCCCACTTCGGCGTCG
GGTCCTCGTCGAGTCCAGAACCTGGATTCTCCTGCGGCTCCCGGGACGCCTGTACCGGGTGCTGGTGGTGAGCCG
CCGTCGCCATCCGCCTTGAGCCCCAGGGCTCTTGCTGACTTGGTGGCAGACGCGAGAAAGGAGAGAGGCTGGAGC
CGGTTCGCTGATTCTTGGTCCGAGCCGGACGAGGGAACGGACAGAGCGCCGTCGCTGGAGAGAGAGACGGCGTCG
CAGTCGGTCGCACAGCCTGTCGTCTCGCAGCGTCGCGGTCACGGTCTGCAGCCACTCGCGGCCGAAGATGGTCAC
AGCCGACCCCTATCGGCTTCCGTCTCCACGCCACTTCTAATGGCTCCGCCCCGGAGCAACATGGGAGAGGCGCGG
TATCAGATGCAGATGGCGGCCCATCGTATCGTTCACACGCTGCGCACCGAGAGGCTTCTTACCAGCTTCGCCACC
CGTCTGGCCTTCTTCCTTCTCAAGCTCGGCACGCTGGCCCGTCCCTGCTGGCCCCTGATGGCGAGTCCTCAAGTG
AGCATCCCACTGGTCGTGGTCGCGGCTCTAGACCTGGTTATGTCTACTGCCGACTCGCCCGTTGCGGAACAGAGG
CGAATGCGTGTCAGTCACGGTTCTCTTCCGCCACTGGATTTCTTCTCTACCGAGGCCGTTACGAGCTTGATCCTG
CTTGCTGTTCACTTTGTTGGGCTGTGGCTTGCGAGGAGATGGGGGTCTTTGTGCGTTGCAGCGCTACCTGATGAC
GACTGGGCGCAGTGGTGA
Transcript >Ophun1|626
ATGTCGCTGATCCCGTACCATCCTCGCGAGGACGGTGAGCTCGTCCTGTTCGTCGCTTCGCAGCAGACTGATGGG
GAGGCGTTGAAACTGACTGCTCCTGACTCCAGCCGCCACCAAAACTCGCTCGTCTACCGAAACCCCGACTCCCTC
CGCCTCGAAATCTACCCTCGGGAATGCCCGACCTGTCACCAGCCGCTGGACCGCGCCTCGTCGTCCGAAGACCGG
CACTATGACTTGGACGGGGAATACGTCGATCCGACCTACTTTCGCAAGCTGCGCGCGGGCACAGAGGCTACGATG
CCGCAGGAGGGCGTGCCCAGCCCTGTTCGCAGGCTGTTTCCTGCACTAGCTGGCAGTGGCAGCGGCAGCGGTAGT
GAGGCACAGCCCGTCGACTCTGACACCTATTTTGGCGACGAAGCCGATGACTCGGTCTCGGGCGCGGGCAGCAGG
ATCCGGTCCGAGGCCTTTAGCCCCAACTACTTCAAGACCTTCTTCGTCGAAGAGACGGTTCTTGGCAGAGGCGGC
AAGGGCGTCGTCTTGCTCGTACGACACGAGATCGACGGTTGCCAGCTGGGTCACTTTGCCTGCAAACGCGTCCCC
GTCGGTGACGACCATGGCTGGCTGGAGAAGGTGTTGATCGAGGTCGAGCTCCTCGCCGCTCTATCGCACCCGAAC
CTCGTCTCGTATCGGCATGTGTGGCTCGAAAATGTCCAGCTCACCCGCTTTGGTCCCAGCGTGGCCTGTGCCTTT
ATCCTGCAGCAGTACTGTAACGGGGGCGACCTTCATCAGTACGTCGTGGGTGGCGCGCCCCGTGAGGCCACCAAG
GAGGAGCTCAAGGCCCAGATGCGCCGTCGTTCCAAGGGTCAGGCCGAGCCGCCTCGCGATCTCGCACAGGGCCAG
CTGCAGCTGTCGTTTGAAGACATCTACTCCTTCTTCAGAGATATCACGTTGGGGGTCGCCTACCTACACACCAAC
AACTACATACACCGCGATCTCAAGCCCAGCAACTGCCTGCTCCACAGCGAAGGCGGCAAGCTGAGGTGCCTCATC
AGCGACTTTGGAGAGGTGCAGCCGAAAGACACGGTTCGGAAGTCGACGGGATCGACAGGCACAATCTCGTACTGC
GCCCCGGAAGTGCTGAAGATGGACGTCGACGGGCGGTACGGAAACTTTACCACCAAGTCGGACATATTCTCCCTC
GGCATGATCCTCTACTTCATGTGCTTCGGTAGGCTGCCATACCAGGGAGCCAACGCCATCCAGGAAGAGCTCGAG
GATATGGAACAGCTCCGGGCCGAGATTGCCGACTGGGAGGGCTTCCAGGACGAGCGACGGGAGAGGCCCGACTTG
CCGACGCGCCTGTACCAGCTGCTAAAGAAGCTGCTGGCCCTAAACCCGGCAGAGCGGCCGAGCGCCAACGAGGTG
CTGACGGCCATGAAGAGCGAGACCAACTTTGGCGGCATCCCGAGGGTCGACAGATCGTCGCCCACTTCGGCGTCG
GGTCCTCGTCGAGTCCAGAACCTGGATTCTCCTGCGGCTCCCGGGACGCCTGTACCGGGTGCTGGTGGTGAGCCG
CCGTCGCCATCCGCCTTGAGCCCCAGGGCTCTTGCTGACTTGGTGGCAGACGCGAGAAAGGAGAGAGGCTGGAGC
CGGTTCGCTGATTCTTGGTCCGAGCCGGACGAGGGAACGGACAGAGCGCCGTCGCTGGAGAGAGAGACGGCGTCG
CAGTCGGTCGCACAGCCTGTCGTCTCGCAGCGTCGCGGTCACGGTCTGCAGCCACTCGCGGCCGAAGATGGTCAC
AGCCGACCCCTATCGGCTTCCGTCTCCACGCCACTTCTAATGGCTCCGCCCCGGAGCAACATGGGAGAGGCGCGG
TATCAGATGCAGATGGCGGCCCATCGTATCGTTCACACGCTGCGCACCGAGAGGCTTCTTACCAGCTTCGCCACC
CGTCTGGCCTTCTTCCTTCTCAAGCTCGGCACGCTGGCCCGTCCCTGCTGGCCCCTGATGGCGAGTCCTCAAGTG
AGCATCCCACTGGTCGTGGTCGCGGCTCTAGACCTGGTTATGTCTACTGCCGACTCGCCCGTTGCGGAACAGAGG
CGAATGCGTGTCAGTCACGGTTCTCTTCCGCCACTGGATTTCTTCTCTACCGAGGCCGTTACGAGCTTGATCCTG
CTTGCTGTTCACTTTGTTGGGCTGTGGCTTGCGAGGAGATGGGGGTCTTTGTGCGTTGCAGCGCTACCTGATGAC
GACTGGGCGCAGTGGTGA
Gene >Ophun1|626
ATGTCGCTGATCCCGTACCATCCTCGCGAGGACGGTGAGCTCGTCCTGTTCGTCGCTTCGCAGCAGACTGATGGG
GAGGCGTTGAAACTGACTGCTCCTGACTCCAGCCGCCACCAAAACTCGCTCGTCTACCGAAACCCCGACTCCCTC
CGCCTCGAAATCTACCCTCGGGAATGCCCGACCTGTCACCAGCCGCTGGACCGCGCCTCGTCGTCCGAAGACCGG
CACTATGACTTGGACGGGGAATACGTCGATCCGACCTACTTTCGCAAGCTGCGCGCGGGCACAGAGGCTACGATG
CCGCAGGAGGGCGTGCCCAGCCCTGTTCGCAGGCTGTTTCCTGCACTAGCTGGCAGTGGCAGCGGCAGCGGTAGT
GAGGCACAGCCCGTCGACTCTGACACCTATTTTGGCGACGAAGCCGATGACTCGGTCTCGGGCGCGGGCAGCAGG
ATCCGGTCCGAGGCCTTTAGCCCCAACTACTTCAAGACCTTCTTCGTCGAAGAGACGGTTCTTGGCAGAGGCGGC
AAGGGCGTCGTCTTGCTCGTACGACACGAGATCGACGGTTGCCAGCTGGGTCACTTTGCCTGCAAACGCGTCCCC
GTCGGTGACGACCATGGCTGGCTGGAGAAGGTGTTGATCGAGGTCGAGCTCCTCGCCGCTCTATCGCACCCGAAC
CTCGTCTCGTATCGGCATGTGTGGCTCGAAAATGTCCAGCTCACCCGCTTTGGTCCCAGCGTGGCCTGTGCCTTT
ATCCTGCAGCAGTACTGTAACGGGGGCGACCTTCATCAGTACGTCGTGGGTGGCGCGCCCCGTGAGGCCACCAAG
GAGGAGCTCAAGGCCCAGATGCGCCGTCGTTCCAAGGGTCAGGCCGAGCCGCCTCGCGATCTCGCACAGGGCCAG
CTGCAGCTGTCGTTTGAAGACATCTACTCCTTCTTCAGAGATATCACGTTGGGGGTCGCCTACCTACACACCAAC
AACTACATACACCGCGATCTCAAGCCCAGCAACTGCCTGCTCCACAGCGAAGGCGGCAAGCTGAGGTGCCTCATC
AGCGACTTTGGAGAGGTGCAGCCGAAAGACACGGTTCGGAAGTCGACGGGATCGACAGGCACAATCTCGTACTGC
GCCCCGGAAGTGCTGAAGATGGACGTCGACGGGCGGTACGGAAACTTTACCACCAAGTCGGACATATTCTCCCTC
GGCATGATCCTCTACTTCATGTGCTTCGGTAGGCTGCCATACCAGGGAGCCAACGCCATCCAGGAAGAGCTCGAG
GATATGGAACAGCTCCGGGCCGAGATTGCCGACTGGGAGGGCTTCCAGGACGAGCGACGGGAGAGGCCCGACTTG
CCGACGCGCCTGTACCAGCTGCTAAAGAAGCTGCTGGCCCTAAACCCGGCAGAGCGGCCGAGCGCCAACGAGGTG
CTGACGGCCATGAAGAGCGAGACCAACTTTGGCGGCATCCCGAGGGTCGACAGATCGTCGCCCACTTCGGCGTCG
GGTCCTCGTCGAGTCCAGAACCTGGATTCTCCTGCGGCTCCCGGGACGCCTGTACCGGGTGCTGGTGGTGAGCCG
CCGTCGCCATCCGCCTTGAGCCCCAGGGCTCTTGCTGACTTGGTGGCAGACGCGAGAAAGGAGAGAGGCTGGAGC
CGGTTCGCTGATTCTTGGTCCGAGCCGGACGAGGGAACGGACAGAGCGCCGTCGCTGGAGAGAGAGACGGCGTCG
CAGTCGGTCGCACAGCCTGTCGTCTCGCAGCGTCGCGGTCACGGTCTGCAGCCACTCGCGGCCGAAGATGGTCAC
AGCCGACCCCTATCGGCTTCCGTCTCCACGCCACTTCTAATGGCTCCGCCCCGGAGCAACATGGGAGAGGCGCGG
TATCAGATGCAGATGGCGGCCCATCGTATCGTTCACACGCTGCGCACCGAGAGGCTTCTTACCAGCTTCGCCACC
CGTCTGGCCTTCTTCCTTCTCAAGCTCGGCACGCTGGCCCGTCCCTGCTGGCCCCTGATGGCGAGTCCTCAAGTG
AGCATCCCACTGGTCGTGGTCGCGGCTCTAGACCTGGTTATGTCTACTGCCGACTCGCCCGTTGCGGAACAGAGG
CGAATGCGTGTCAGTCACGGTTCTCTTCCGCCACTGGATTTCTTCTCTACCGAGGCCGTTACGAGCTTGATCCTG
CTTGCTGTTCACTTTGTTGGGCTGTGGCTTGCGAGGAGATGGGGGTCTTTGTGCGTTGCAGCGCTACCTGATGAC
GACTGGGCGCAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail