Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|626
Gene name
LocationContig_12:31089..33357
Strand+
Gene length (bp)2268
Transcript length (bp)2268
Coding sequence length (bp)2268
Protein length (aa) 756

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.4E-42 166 477
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.1E-30 169 477

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 149 478 4.0E-54
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 151 475 5.0E-46
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 151 501 2.0E-21
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 214 497 2.0E-20
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 159 477 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 149 478 4.0E-54
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 151 475 5.0E-46
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 151 501 2.0E-21
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 214 497 2.0E-20
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 159 477 4.0E-20
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 146 476 2.0E-19
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 171 476 2.0E-19
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 171 477 5.0E-19
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 151 479 8.0E-19
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 170 476 2.0E-18
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 151 475 2.0E-18
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 170 476 5.0E-18
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 170 476 6.0E-18
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 146 477 8.0E-18
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 161 404 9.0E-18
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 171 477 1.0E-17
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 191 414 1.0E-17
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 171 414 2.0E-17
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 165 475 3.0E-17
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 171 476 6.0E-17
sp|Q61UC4|KRAF1_CAEBR Raf homolog serine/threonine-protein kinase OS=Caenorhabditis briggsae GN=lin-45 PE=3 SV=2 165 494 1.0E-16
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 170 477 1.0E-16
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 150 475 1.0E-16
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 161 420 1.0E-16
sp|Q07292|KRAF1_CAEEL Raf homolog serine/threonine-protein kinase OS=Caenorhabditis elegans GN=lin-45 PE=1 SV=2 165 494 1.0E-16
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 170 476 2.0E-16
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 165 480 2.0E-16
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 175 477 2.0E-16
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 146 521 3.0E-16
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 150 469 4.0E-16
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 170 476 4.0E-16
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 171 476 5.0E-16
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 171 479 5.0E-16
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 170 476 5.0E-16
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 170 476 5.0E-16
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 165 476 6.0E-16
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 205 476 6.0E-16
sp|G5ECJ6|CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans GN=csk-1 PE=1 SV=1 185 484 6.0E-16
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 161 477 6.0E-16
sp|Q80ZW0|STK35_MOUSE Serine/threonine-protein kinase 35 OS=Mus musculus GN=Stk35 PE=1 SV=3 250 483 7.0E-16
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 315 477 7.0E-16
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 171 477 7.0E-16
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 171 478 1.0E-15
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 171 476 1.0E-15
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 150 469 1.0E-15
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 106 469 1.0E-15
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 170 478 1.0E-15
sp|Q8TDR2|STK35_HUMAN Serine/threonine-protein kinase 35 OS=Homo sapiens GN=STK35 PE=1 SV=2 209 483 1.0E-15
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 170 476 1.0E-15
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 170 476 2.0E-15
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 170 523 2.0E-15
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 170 476 2.0E-15
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 162 476 2.0E-15
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 313 476 2.0E-15
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 171 476 2.0E-15
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 146 521 2.0E-15
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 146 521 2.0E-15
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 170 502 2.0E-15
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 170 476 2.0E-15
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 165 476 2.0E-15
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 170 519 3.0E-15
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 170 476 3.0E-15
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 171 476 3.0E-15
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 170 476 3.0E-15
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 161 477 3.0E-15
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 170 476 3.0E-15
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 106 591 4.0E-15
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 164 476 4.0E-15
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 161 477 5.0E-15
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 175 490 6.0E-15
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 168 617 6.0E-15
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 171 476 6.0E-15
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 171 476 7.0E-15
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 159 475 7.0E-15
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 159 475 7.0E-15
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 139 476 8.0E-15
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 159 475 8.0E-15
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 139 476 9.0E-15
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 165 473 9.0E-15
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 171 475 9.0E-15
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 171 476 1.0E-14
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 302 476 1.0E-14
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 165 476 1.0E-14
sp|Q9QY78|IKKB_RAT Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Rattus norvegicus GN=Ikbkb PE=1 SV=1 171 414 1.0E-14
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 168 617 1.0E-14
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 171 477 1.0E-14
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 111 411 1.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 170 416 2.0E-14
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 206 476 2.0E-14
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 209 476 2.0E-14
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 161 477 2.0E-14
sp|P0C1X8|AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus GN=Aak1 PE=1 SV=1 168 617 2.0E-14
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 295 476 2.0E-14
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 208 477 2.0E-14
sp|P10447|ABL_FSVHY Tyrosine-protein kinase transforming protein Abl OS=Feline sarcoma virus (strain Hardy-Zuckerman 2) GN=ABL PE=2 SV=1 208 475 2.0E-14
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 165 475 2.0E-14
sp|O14920|IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens GN=IKBKB PE=1 SV=1 171 414 3.0E-14
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 170 477 3.0E-14
sp|P09769|FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens GN=FGR PE=1 SV=2 318 471 3.0E-14
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 170 526 3.0E-14
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 162 476 3.0E-14
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 170 504 3.0E-14
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 136 477 3.0E-14
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 170 526 4.0E-14
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 168 418 4.0E-14
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 307 476 4.0E-14
sp|Q95KV0|IKKB_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Bos taurus GN=IKBKB PE=2 SV=1 171 414 4.0E-14
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 171 522 4.0E-14
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 170 500 4.0E-14
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 165 418 4.0E-14
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 171 414 4.0E-14
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 170 526 5.0E-14
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 168 418 5.0E-14
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 313 477 5.0E-14
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 170 486 5.0E-14
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 165 477 5.0E-14
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 302 476 5.0E-14
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 170 476 5.0E-14
sp|O88351|IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus GN=Ikbkb PE=1 SV=1 171 414 6.0E-14
sp|Q3UHJ0|AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus GN=Aak1 PE=1 SV=2 168 414 6.0E-14
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 170 476 6.0E-14
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 145 418 6.0E-14
sp|P00532|RAF_MSV36 Serine/threonine-protein kinase-transforming protein raf OS=Murine sarcoma virus 3611 GN=V-RAF PE=3 SV=1 313 496 6.0E-14
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 170 471 7.0E-14
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 164 475 7.0E-14
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 171 522 7.0E-14
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 168 418 7.0E-14
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 168 476 7.0E-14
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 176 478 7.0E-14
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 314 480 8.0E-14
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 170 526 8.0E-14
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 295 476 1.0E-13
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 171 476 1.0E-13
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 171 476 1.0E-13
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 171 475 1.0E-13
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 214 492 1.0E-13
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 315 477 1.0E-13
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 171 485 1.0E-13
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 214 479 1.0E-13
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 171 414 1.0E-13
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 162 478 1.0E-13
sp|Q95KV1|IKKA_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Bos taurus GN=CHUK PE=1 SV=1 171 414 1.0E-13
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 168 414 1.0E-13
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 165 478 1.0E-13
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 169 473 2.0E-13
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 170 526 2.0E-13
sp|O15111|IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens GN=CHUK PE=1 SV=2 171 414 2.0E-13
sp|P54754|EPHB3_MOUSE Ephrin type-B receptor 3 OS=Mus musculus GN=Ephb3 PE=1 SV=2 168 502 2.0E-13
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 163 478 2.0E-13
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 171 428 2.0E-13
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 168 493 2.0E-13
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 170 526 2.0E-13
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 165 475 2.0E-13
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 168 418 2.0E-13
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 165 418 2.0E-13
sp|Q6NU47|PDK1A_XENLA Serine/threonine-protein kinase pdik1l-A OS=Xenopus laevis GN=pdik1-a PE=2 SV=1 242 475 2.0E-13
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 170 526 2.0E-13
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 295 476 2.0E-13
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 164 475 2.0E-13
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 171 476 2.0E-13
sp|P42683|LCK_CHICK Proto-oncogene tyrosine-protein kinase LCK OS=Gallus gallus GN=LCK PE=2 SV=2 301 471 2.0E-13
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 165 491 2.0E-13
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 209 489 2.0E-13
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 242 475 2.0E-13
sp|P31152|MK04_HUMAN Mitogen-activated protein kinase 4 OS=Homo sapiens GN=MAPK4 PE=1 SV=2 165 472 2.0E-13
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 165 491 2.0E-13
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 170 485 2.0E-13
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 164 475 2.0E-13
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 172 475 3.0E-13
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 151 477 3.0E-13
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 214 476 3.0E-13
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 171 476 3.0E-13
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 171 476 3.0E-13
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 168 418 3.0E-13
sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 GN=V-RMIL PE=3 SV=1 301 522 3.0E-13
sp|P08103|HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus GN=Hck PE=1 SV=4 308 479 3.0E-13
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 303 508 3.0E-13
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 162 507 3.0E-13
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 170 418 4.0E-13
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 168 418 4.0E-13
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 171 477 4.0E-13
sp|P50545|HCK_RAT Tyrosine-protein kinase HCK OS=Rattus norvegicus GN=Hck PE=1 SV=4 308 479 4.0E-13
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 159 421 4.0E-13
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 214 421 4.0E-13
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 170 487 4.0E-13
sp|P06239|LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens GN=LCK PE=1 SV=6 301 480 4.0E-13
sp|Q9Z139|ROR1_MOUSE Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Mus musculus GN=Ror1 PE=2 SV=2 214 525 5.0E-13
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 171 476 5.0E-13
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 170 476 5.0E-13
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 170 538 5.0E-13
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 306 476 5.0E-13
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 136 477 5.0E-13
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 170 476 5.0E-13
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 171 475 6.0E-13
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 144 480 6.0E-13
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 170 418 6.0E-13
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 171 476 6.0E-13
sp|Q01973|ROR1_HUMAN Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens GN=ROR1 PE=1 SV=2 214 525 7.0E-13
sp|Q6P6U0|FGR_RAT Tyrosine-protein kinase Fgr OS=Rattus norvegicus GN=Fgr PE=1 SV=1 318 471 7.0E-13
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 165 421 7.0E-13
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 153 418 8.0E-13
sp|P42690|SRK4_SPOLA Tyrosine-protein kinase isoform SRK4 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 303 471 8.0E-13
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 159 421 8.0E-13
sp|Q9Z335|SBK1_RAT Serine/threonine-protein kinase SBK1 OS=Rattus norvegicus GN=Sbk1 PE=1 SV=1 171 482 8.0E-13
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 168 421 8.0E-13
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 171 484 8.0E-13
sp|Q9CAL8|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13 OS=Arabidopsis thaliana GN=PERK13 PE=2 SV=1 165 499 9.0E-13
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 171 482 9.0E-13
sp|P10533|RMIL_AVII1 Serine/threonine-protein kinase-transforming protein Rmil OS=Avian retrovirus IC10 GN=V-RMIL PE=3 SV=1 301 518 9.0E-13
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 171 519 1.0E-12
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 164 475 1.0E-12
sp|Q54R58|YTYK2_DICDI Probable tyrosine-protein kinase DDB_G0283397 OS=Dictyostelium discoideum GN=DDB_G0283397 PE=3 SV=1 214 480 1.0E-12
sp|P00541|FPS_AVISP Tyrosine-protein kinase transforming protein Fps OS=Avian sarcoma virus (strain PRCII) GN=V-FPS PE=3 SV=1 171 475 1.0E-12
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 157 477 1.0E-12
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 171 420 1.0E-12
sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens GN=BRAF PE=1 SV=4 313 522 1.0E-12
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 214 477 1.0E-12
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 171 469 1.0E-12
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 295 476 1.0E-12
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 170 526 1.0E-12
sp|P28028|BRAF_MOUSE Serine/threonine-protein kinase B-raf OS=Mus musculus GN=Braf PE=1 SV=3 313 522 1.0E-12
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 170 420 1.0E-12
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 159 475 1.0E-12
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 165 477 1.0E-12
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 159 475 1.0E-12
sp|P08631|HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens GN=HCK PE=1 SV=5 308 479 1.0E-12
sp|Q04982|BRAF_CHICK Serine/threonine-protein kinase B-raf OS=Gallus gallus GN=BRAF PE=1 SV=1 313 525 1.0E-12
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 164 475 1.0E-12
sp|Q54H05|KINY_DICDI Probable serine/threonine-protein kinase kinY OS=Dictyostelium discoideum GN=kinY PE=2 SV=1 214 511 1.0E-12
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 311 475 1.0E-12
sp|Q05688|IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus GN=IGF1R PE=2 SV=1 314 486 1.0E-12
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 206 476 1.0E-12
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 170 418 1.0E-12
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 214 477 1.0E-12
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 161 420 1.0E-12
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 171 476 1.0E-12
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 168 476 1.0E-12
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 67 476 1.0E-12
sp|P34908|BRAF_COTJA Serine/threonine-protein kinase B-raf OS=Coturnix coturnix japonica GN=BRAF PE=2 SV=1 313 522 2.0E-12
sp|Q8QZR7|PDK1L_MOUSE Serine/threonine-protein kinase PDIK1L OS=Mus musculus GN=Pdik1l PE=2 SV=1 250 475 2.0E-12
sp|P00530|FPS_FUJSV Tyrosine-protein kinase transforming protein Fps OS=Fujinami sarcoma virus GN=V-FPS PE=3 SV=1 171 475 2.0E-12
sp|Q60680|IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus GN=Chuk PE=1 SV=1 171 414 2.0E-12
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 161 420 2.0E-12
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 161 420 2.0E-12
sp|P47355|PKNS_MYCGE Putative serine/threonine-protein kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG109 PE=3 SV=2 168 431 2.0E-12
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 310 476 2.0E-12
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 313 495 2.0E-12
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 214 477 2.0E-12
sp|Q95KR7|LCK_SAISC Proto-oncogene tyrosine-protein kinase LCK OS=Saimiri sciureus GN=LCK PE=1 SV=3 301 480 2.0E-12
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 159 476 2.0E-12
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 171 477 2.0E-12
sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus GN=Tec PE=1 SV=2 296 486 2.0E-12
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 171 519 2.0E-12
sp|Q99N57|RAF1_MOUSE RAF proto-oncogene serine/threonine-protein kinase OS=Mus musculus GN=Raf1 PE=1 SV=2 313 495 2.0E-12
sp|Q07494|EPHB1_CHICK Ephrin type-B receptor 1 (Fragment) OS=Gallus gallus GN=EPHB1 PE=2 SV=2 121 479 2.0E-12
sp|Q07497|EPHB5_CHICK Ephrin type-B receptor 5 OS=Gallus gallus GN=EPHB5 PE=2 SV=1 81 479 2.0E-12
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 223 476 2.0E-12
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 171 428 2.0E-12
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 171 428 2.0E-12
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 303 500 2.0E-12
sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus GN=Txk PE=1 SV=1 298 479 2.0E-12
sp|Q07014|LYN_RAT Tyrosine-protein kinase Lyn OS=Rattus norvegicus GN=Lyn PE=1 SV=3 308 479 2.0E-12
sp|Q2H6X2|ATG1_CHAGB Serine/threonine-protein kinase ATG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG1 PE=3 SV=1 165 471 2.0E-12
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 171 475 2.0E-12
sp|P11346|KRAF1_DROME Raf homolog serine/threonine-protein kinase phl OS=Drosophila melanogaster GN=phl PE=1 SV=6 313 514 2.0E-12
sp|O73798|IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis GN=igf1r PE=1 SV=1 274 486 2.0E-12
sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus GN=Lyn PE=1 SV=4 308 479 3.0E-12
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 297 477 3.0E-12
sp|Q8N165|PDK1L_HUMAN Serine/threonine-protein kinase PDIK1L OS=Homo sapiens GN=PDIK1L PE=1 SV=1 250 475 3.0E-12
sp|P14234|FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus GN=Fgr PE=1 SV=2 318 471 3.0E-12
sp|Q1KL86|EPHA2_MACFA Ephrin type-A receptor 2 OS=Macaca fascicularis GN=EPHA2 PE=2 SV=1 302 479 3.0E-12
sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus GN=Ephb1 PE=1 SV=1 163 479 3.0E-12
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 208 418 3.0E-12
sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus GN=Ephb1 PE=1 SV=2 163 479 3.0E-12
sp|P29317|EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens GN=EPHA2 PE=1 SV=2 302 479 3.0E-12
sp|Q91Z96|BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus GN=Bmp2k PE=1 SV=1 168 414 3.0E-12
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 205 421 3.0E-12
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 208 469 3.0E-12
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 206 421 3.0E-12
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 191 476 3.0E-12
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 176 476 3.0E-12
sp|Q6EWH2|FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio GN=fyna PE=1 SV=2 315 471 3.0E-12
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 165 422 3.0E-12
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 158 493 3.0E-12
sp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 15 OS=Oryza sativa subsp. japonica GN=MPK15 PE=2 SV=1 168 493 3.0E-12
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 308 479 3.0E-12
sp|Q8TFN2|ATG1_PICAN Serine/threonine-protein kinase ATG1 OS=Pichia angusta GN=ATG1 PE=3 SV=1 204 469 3.0E-12
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 170 532 3.0E-12
sp|P27446|FYN_XIPHE Tyrosine-protein kinase Fyn OS=Xiphophorus helleri GN=fyn PE=2 SV=3 315 471 3.0E-12
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 194 471 4.0E-12
sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens GN=EPHB1 PE=1 SV=1 163 479 4.0E-12
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 171 420 4.0E-12
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 214 444 4.0E-12
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 170 414 4.0E-12
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 310 476 4.0E-12
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 206 476 4.0E-12
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 208 469 4.0E-12
sp|Q93V58|GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana GN=GRIK1 PE=1 SV=1 152 475 4.0E-12
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 170 416 4.0E-12
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 310 477 4.0E-12
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 136 477 4.0E-12
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 170 476 4.0E-12
sp|Q01621|LCK_RAT Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus GN=Lck PE=1 SV=3 301 471 5.0E-12
sp|Q5PXS1|LCK_AOTNA Tyrosine-protein kinase Lck OS=Aotus nancymaae GN=LCK PE=2 SV=4 301 480 5.0E-12
sp|Q96S53|TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens GN=TESK2 PE=1 SV=1 171 578 5.0E-12
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 153 476 5.0E-12
sp|Q32PP3|PDK1L_DANRE Serine/threonine-protein kinase pdik1l OS=Danio rerio GN=pdik1l PE=2 SV=1 208 475 5.0E-12
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 170 476 5.0E-12
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 165 422 5.0E-12
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 168 413 5.0E-12
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 309 541 5.0E-12
sp|Q9LSE1|CDG1_ARATH Serine/threonine-protein kinase CDG1 OS=Arabidopsis thaliana GN=CDG1 PE=1 SV=1 123 411 5.0E-12
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 171 516 5.0E-12
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 171 516 5.0E-12
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 170 526 5.0E-12
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 209 476 5.0E-12
sp|P11345|RAF1_RAT RAF proto-oncogene serine/threonine-protein kinase OS=Rattus norvegicus GN=Raf1 PE=1 SV=1 313 495 5.0E-12
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 209 476 6.0E-12
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 170 478 6.0E-12
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 144 578 6.0E-12
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 311 476 6.0E-12
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 171 475 6.0E-12
sp|P06240|LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus GN=Lck PE=1 SV=4 301 471 6.0E-12
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 170 526 6.0E-12
sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 168 414 6.0E-12
sp|Q24488|ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster GN=Ror PE=1 SV=1 214 481 7.0E-12
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 307 414 7.0E-12
sp|Q5RER6|PDK1L_PONAB Serine/threonine-protein kinase PDIK1L OS=Pongo abelii GN=PDIK1L PE=2 SV=2 250 475 7.0E-12
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 171 482 7.0E-12
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 170 414 7.0E-12
sp|P14617|INSRR_CAVPO Insulin receptor-related protein OS=Cavia porcellus GN=INSRR PE=3 SV=1 274 482 8.0E-12
sp|P54936|LIN2_CAEEL Protein lin-2 OS=Caenorhabditis elegans GN=lin-2 PE=1 SV=1 208 477 8.0E-12
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 168 493 8.0E-12
sp|Q8SQW2|CTK1_ENCCU Probable CTD kinase subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CTK1 PE=3 SV=1 170 476 8.0E-12
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 206 476 8.0E-12
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 168 420 8.0E-12
sp|F1RDG9|FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio GN=fynb PE=2 SV=1 318 471 8.0E-12
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 164 476 8.0E-12
sp|Q55CZ1|GDT2_DICDI Probable serine/threonine-protein kinase gdt2 OS=Dictyostelium discoideum GN=gdt2 PE=2 SV=1 204 480 8.0E-12
sp|P54753|EPHB3_HUMAN Ephrin type-B receptor 3 OS=Homo sapiens GN=EPHB3 PE=1 SV=2 168 502 9.0E-12
sp|Q63604|NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus GN=Ntrk2 PE=1 SV=1 214 481 9.0E-12
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 307 483 9.0E-12
sp|A7E3S4|RAF1_BOVIN RAF proto-oncogene serine/threonine-protein kinase OS=Bos taurus GN=RAF1 PE=2 SV=1 313 495 9.0E-12
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 170 418 9.0E-12
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 67 476 9.0E-12
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 156 476 9.0E-12
sp|Q6P5G0|MK04_MOUSE Mitogen-activated protein kinase 4 OS=Mus musculus GN=Mapk4 PE=1 SV=1 165 472 1.0E-11
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 170 418 1.0E-11
sp|Q62844|FYN_RAT Tyrosine-protein kinase Fyn OS=Rattus norvegicus GN=Fyn PE=1 SV=1 209 471 1.0E-11
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 171 416 1.0E-11
sp|A1Y2K1|FYN_PIG Tyrosine-protein kinase Fyn OS=Sus scrofa GN=FYN PE=2 SV=2 209 471 1.0E-11
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 211 476 1.0E-11
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 206 476 1.0E-11
sp|P06241|FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 209 471 1.0E-11
sp|P15209|NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus GN=Ntrk2 PE=1 SV=1 214 481 1.0E-11
sp|P39688|FYN_MOUSE Tyrosine-protein kinase Fyn OS=Mus musculus GN=Fyn PE=1 SV=4 315 471 1.0E-11
sp|P08069|IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens GN=IGF1R PE=1 SV=1 314 482 1.0E-11
sp|Q05876|FYN_CHICK Tyrosine-protein kinase Fyn OS=Gallus gallus GN=FYN PE=1 SV=2 315 471 1.0E-11
sp|Q91736|EPB1B_XENLA Ephrin type-B receptor 1-B (Fragment) OS=Xenopus laevis GN=ephb1-b PE=1 SV=1 99 479 1.0E-11
sp|P30530|UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens GN=AXL PE=1 SV=3 208 475 1.0E-11
sp|A0JNB0|FYN_BOVIN Tyrosine-protein kinase Fyn OS=Bos taurus GN=FYN PE=2 SV=1 209 471 1.0E-11
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 165 586 1.0E-11
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 165 586 1.0E-11
sp|P05625|RAF1_CHICK RAF proto-oncogene serine/threonine-protein kinase OS=Gallus gallus GN=RAF1 PE=2 SV=1 313 495 1.0E-11
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 165 418 1.0E-11
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 309 475 1.0E-11
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 192 421 1.0E-11
sp|P25848|PHY1_CERPU Light-sensor Protein kinase OS=Ceratodon purpureus GN=PHY1 PE=3 SV=3 214 480 1.0E-11
sp|Q13308|PTK7_HUMAN Inactive tyrosine-protein kinase 7 OS=Homo sapiens GN=PTK7 PE=1 SV=2 214 483 1.0E-11
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 165 476 1.0E-11
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 195 475 1.0E-11
sp|P13406|FYN_XENLA Tyrosine-protein kinase Fyn OS=Xenopus laevis GN=fyn PE=2 SV=3 315 471 1.0E-11
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 171 469 1.0E-11
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 208 414 1.0E-11
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 168 420 1.0E-11
sp|Q5R5M7|RAF1_PONAB RAF proto-oncogene serine/threonine-protein kinase OS=Pongo abelii GN=RAF1 PE=2 SV=1 313 495 1.0E-11
sp|P04049|RAF1_HUMAN RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens GN=RAF1 PE=1 SV=1 313 495 1.0E-11
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 165 477 1.0E-11
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 310 476 1.0E-11
sp|Q9Z138|ROR2_MOUSE Tyrosine-protein kinase transmembrane receptor ROR2 OS=Mus musculus GN=Ror2 PE=1 SV=2 209 500 1.0E-11
sp|Q03145|EPHA2_MOUSE Ephrin type-A receptor 2 OS=Mus musculus GN=Epha2 PE=1 SV=3 197 479 1.0E-11
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 206 476 1.0E-11
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 171 477 1.0E-11
sp|Q54QD5|NEK1_DICDI Probable serine/threonine-protein kinase nek1 OS=Dictyostelium discoideum GN=nek1 PE=3 SV=1 171 476 2.0E-11
sp|P00522|ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster GN=Abl PE=1 SV=3 180 480 2.0E-11
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 164 477 2.0E-11
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 171 482 2.0E-11
sp|Q60751|IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus GN=Igf1r PE=1 SV=3 314 482 2.0E-11
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 314 480 2.0E-11
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 170 418 2.0E-11
sp|Q16620|NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens GN=NTRK2 PE=1 SV=1 214 481 2.0E-11
sp|Q07498|EPHB3_CHICK Ephrin type-B receptor 3 (Fragment) OS=Gallus gallus GN=EPHB3 PE=2 SV=1 168 479 2.0E-11
sp|Q6GM53|IKKA_XENLA Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus laevis GN=chuk PE=2 SV=1 171 414 2.0E-11
sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform SRK1 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 303 471 2.0E-11
sp|P24062|IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus GN=Igf1r PE=2 SV=2 314 482 2.0E-11
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 171 475 2.0E-11
sp|P93050|RKF3_ARATH Probable LRR receptor-like serine/threonine-protein kinase RKF3 OS=Arabidopsis thaliana GN=RKF3 PE=2 SV=1 165 437 2.0E-11
sp|P09208|INSR_DROME Insulin-like receptor OS=Drosophila melanogaster GN=InR PE=1 SV=3 249 480 2.0E-11
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 306 476 2.0E-11
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 149 414 2.0E-11
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 170 480 2.0E-11
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 233 421 2.0E-11
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 314 479 2.0E-11
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 170 477 2.0E-11
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 315 481 2.0E-11
sp|Q9YI66|TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio GN=tyro3 PE=2 SV=1 208 480 2.0E-11
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 214 477 3.0E-11
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 209 475 3.0E-11
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 140 479 3.0E-11
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 67 476 3.0E-11
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 164 414 3.0E-11
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 206 421 3.0E-11
sp|Q95M30|HCK_MACFA Tyrosine-protein kinase HCK OS=Macaca fascicularis GN=HCK PE=2 SV=3 308 479 3.0E-11
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 171 475 3.0E-11
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 311 477 3.0E-11
sp|P09560|RAF1_XENLA RAF proto-oncogene serine/threonine-protein kinase OS=Xenopus laevis GN=raf1 PE=2 SV=1 313 495 3.0E-11
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 171 475 3.0E-11
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 315 471 3.0E-11
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 170 484 3.0E-11
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 208 479 3.0E-11
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 214 476 3.0E-11
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 171 480 3.0E-11
sp|P14616|INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens GN=INSRR PE=1 SV=2 274 482 3.0E-11
sp|Q8BKG3|PTK7_MOUSE Inactive tyrosine-protein kinase 7 OS=Mus musculus GN=Ptk7 PE=1 SV=1 214 479 3.0E-11
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 303 477 3.0E-11
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 165 505 3.0E-11
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 165 420 3.0E-11
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 206 421 3.0E-11
sp|Q06418|TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens GN=TYRO3 PE=1 SV=1 208 538 3.0E-11
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 171 476 3.0E-11
sp|Q9SYS7|CRK39_ARATH Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=3 SV=1 165 490 3.0E-11
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 164 474 3.0E-11
sp|P08923|LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus GN=Ltk PE=1 SV=3 212 484 4.0E-11
sp|P21709|EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens GN=EPHA1 PE=1 SV=4 302 470 4.0E-11
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 171 479 4.0E-11
sp|P51813|BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens GN=BMX PE=1 SV=1 171 480 4.0E-11
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 171 420 4.0E-11
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 194 477 4.0E-11
sp|P54755|EPHA5_CHICK Ephrin type-A receptor 5 OS=Gallus gallus GN=EPHA5 PE=2 SV=1 168 515 4.0E-11
sp|Q64716|INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus GN=Insrr PE=1 SV=3 274 482 4.0E-11
sp|P55144|TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus GN=Tyro3 PE=1 SV=2 208 471 4.0E-11
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 170 418 4.0E-11
sp|P55146|TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus norvegicus GN=Tyro3 PE=1 SV=1 208 471 4.0E-11
sp|Q62407|SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus GN=Speg PE=1 SV=2 165 476 4.0E-11
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 170 476 4.0E-11
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 206 476 4.0E-11
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 206 421 4.0E-11
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 67 426 4.0E-11
sp|A0JM20|TYRO3_XENTR Tyrosine-protein kinase receptor TYRO3 OS=Xenopus tropicalis GN=tyro3 PE=2 SV=1 208 471 4.0E-11
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 170 477 4.0E-11
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 171 476 4.0E-11
sp|P75524|PKNS_MYCPN Putative serine/threonine-protein kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_248 PE=3 SV=1 294 431 4.0E-11
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 171 476 5.0E-11
sp|P42681|TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens GN=TXK PE=1 SV=3 296 479 5.0E-11
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 171 475 5.0E-11
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 154 418 5.0E-11
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 162 418 5.0E-11
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 171 475 5.0E-11
sp|P42680|TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens GN=TEC PE=1 SV=2 296 415 5.0E-11
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 162 476 5.0E-11
sp|P54761|EPHB4_MOUSE Ephrin type-B receptor 4 OS=Mus musculus GN=Ephb4 PE=1 SV=2 136 479 5.0E-11
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 165 414 5.0E-11
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 205 485 6.0E-11
sp|E2RSS3|WEE2_CANLF Wee1-like protein kinase 2 OS=Canis lupus familiaris GN=WEE2 PE=3 SV=1 161 472 6.0E-11
sp|P97504|BMX_MOUSE Cytoplasmic tyrosine-protein kinase BMX OS=Mus musculus GN=Bmx PE=2 SV=1 314 480 6.0E-11
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 299 474 6.0E-11
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 221 420 6.0E-11
sp|P13116|SRC2_XENLA Tyrosine-protein kinase Src-2 OS=Xenopus laevis GN=src-b PE=2 SV=3 315 471 6.0E-11
sp|P21965|MCK1_YEAST Protein kinase MCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCK1 PE=1 SV=1 140 444 6.0E-11
sp|P54760|EPHB4_HUMAN Ephrin type-B receptor 4 OS=Homo sapiens GN=EPHB4 PE=1 SV=2 136 479 6.0E-11
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 165 493 6.0E-11
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 303 471 7.0E-11
sp|Q1LX51|WEE2_DANRE Wee1-like protein kinase 2 OS=Danio rerio GN=wee2 PE=2 SV=2 161 473 7.0E-11
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 308 476 7.0E-11
sp|P00527|YES_AVISY Tyrosine-protein kinase transforming protein Yes (Fragment) OS=Avian sarcoma virus (strain Y73) GN=V-YES PE=3 SV=2 315 471 7.0E-11
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 306 414 7.0E-11
sp|P13115|SRC1_XENLA Tyrosine-protein kinase Src-1 OS=Xenopus laevis GN=src-a PE=2 SV=4 315 471 7.0E-11
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 209 522 8.0E-11
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 131 404 8.0E-11
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 106 404 8.0E-11
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 206 476 8.0E-11
sp|P32593|MOS_MSVMT Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain ts110) GN=V-MOS PE=3 SV=1 302 416 8.0E-11
sp|P41239|CSK_CHICK Tyrosine-protein kinase CSK OS=Gallus gallus GN=CSK PE=2 SV=1 180 475 8.0E-11
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 308 482 8.0E-11
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 310 476 8.0E-11
sp|Q28DZ1|IKKA_XENTR Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus tropicalis GN=chuk PE=2 SV=1 171 414 9.0E-11
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 171 552 9.0E-11
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 170 472 9.0E-11
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 315 471 9.0E-11
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 221 420 9.0E-11
sp|P15054|SRC_AVIS2 Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain PR2257) GN=V-SRC PE=3 SV=3 295 471 9.0E-11
sp|P25020|SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) GN=V-SRC PE=1 SV=3 295 471 9.0E-11
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 165 477 9.0E-11
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 206 476 9.0E-11
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 170 472 9.0E-11
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 164 474 1.0E-10
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 194 416 1.0E-10
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 303 476 1.0E-10
sp|P00526|SRC_RSVP Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Prague C) GN=V-SRC PE=1 SV=3 295 471 1.0E-10
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 319 488 1.0E-10
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 315 476 7.0E-10
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 315 476 1.0E-09
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 319 476 2.0E-09
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 310 476 5.0E-09
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 315 476 3.0E-08
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 315 476 4.0E-08
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 315 476 5.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 315 476 5.0E-08
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 321 476 1.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 318 481 2.0E-06
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 319 414 2.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 319 476 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4558
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5696
Ophiocordyceps australis map64 (Brazil) OphauB2|8035
Ophiocordyceps camponoti-floridani Ophcf2|00064
Ophiocordyceps camponoti-rufipedis Ophun1|626 (this protein)
Ophiocordyceps kimflemingae Ophio5|3194
Ophiocordyceps subramaniannii Hirsu2|9539

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|626
MSLIPYHPREDGELVLFVASQQTDGEALKLTAPDSSRHQNSLVYRNPDSLRLEIYPRECPTCHQPLDRASSSEDR
HYDLDGEYVDPTYFRKLRAGTEATMPQEGVPSPVRRLFPALAGSGSGSGSEAQPVDSDTYFGDEADDSVSGAGSR
IRSEAFSPNYFKTFFVEETVLGRGGKGVVLLVRHEIDGCQLGHFACKRVPVGDDHGWLEKVLIEVELLAALSHPN
LVSYRHVWLENVQLTRFGPSVACAFILQQYCNGGDLHQYVVGGAPREATKEELKAQMRRRSKGQAEPPRDLAQGQ
LQLSFEDIYSFFRDITLGVAYLHTNNYIHRDLKPSNCLLHSEGGKLRCLISDFGEVQPKDTVRKSTGSTGTISYC
APEVLKMDVDGRYGNFTTKSDIFSLGMILYFMCFGRLPYQGANAIQEELEDMEQLRAEIADWEGFQDERRERPDL
PTRLYQLLKKLLALNPAERPSANEVLTAMKSETNFGGIPRVDRSSPTSASGPRRVQNLDSPAAPGTPVPGAGGEP
PSPSALSPRALADLVADARKERGWSRFADSWSEPDEGTDRAPSLERETASQSVAQPVVSQRRGHGLQPLAAEDGH
SRPLSASVSTPLLMAPPRSNMGEARYQMQMAAHRIVHTLRTERLLTSFATRLAFFLLKLGTLARPCWPLMASPQV
SIPLVVVAALDLVMSTADSPVAEQRRMRVSHGSLPPLDFFSTEAVTSLILLAVHFVGLWLARRWGSLCVAALPDD
DWAQW*
Coding >Ophun1|626
ATGTCGCTGATCCCGTACCATCCTCGCGAGGACGGTGAGCTCGTCCTGTTCGTCGCTTCGCAGCAGACTGATGGG
GAGGCGTTGAAACTGACTGCTCCTGACTCCAGCCGCCACCAAAACTCGCTCGTCTACCGAAACCCCGACTCCCTC
CGCCTCGAAATCTACCCTCGGGAATGCCCGACCTGTCACCAGCCGCTGGACCGCGCCTCGTCGTCCGAAGACCGG
CACTATGACTTGGACGGGGAATACGTCGATCCGACCTACTTTCGCAAGCTGCGCGCGGGCACAGAGGCTACGATG
CCGCAGGAGGGCGTGCCCAGCCCTGTTCGCAGGCTGTTTCCTGCACTAGCTGGCAGTGGCAGCGGCAGCGGTAGT
GAGGCACAGCCCGTCGACTCTGACACCTATTTTGGCGACGAAGCCGATGACTCGGTCTCGGGCGCGGGCAGCAGG
ATCCGGTCCGAGGCCTTTAGCCCCAACTACTTCAAGACCTTCTTCGTCGAAGAGACGGTTCTTGGCAGAGGCGGC
AAGGGCGTCGTCTTGCTCGTACGACACGAGATCGACGGTTGCCAGCTGGGTCACTTTGCCTGCAAACGCGTCCCC
GTCGGTGACGACCATGGCTGGCTGGAGAAGGTGTTGATCGAGGTCGAGCTCCTCGCCGCTCTATCGCACCCGAAC
CTCGTCTCGTATCGGCATGTGTGGCTCGAAAATGTCCAGCTCACCCGCTTTGGTCCCAGCGTGGCCTGTGCCTTT
ATCCTGCAGCAGTACTGTAACGGGGGCGACCTTCATCAGTACGTCGTGGGTGGCGCGCCCCGTGAGGCCACCAAG
GAGGAGCTCAAGGCCCAGATGCGCCGTCGTTCCAAGGGTCAGGCCGAGCCGCCTCGCGATCTCGCACAGGGCCAG
CTGCAGCTGTCGTTTGAAGACATCTACTCCTTCTTCAGAGATATCACGTTGGGGGTCGCCTACCTACACACCAAC
AACTACATACACCGCGATCTCAAGCCCAGCAACTGCCTGCTCCACAGCGAAGGCGGCAAGCTGAGGTGCCTCATC
AGCGACTTTGGAGAGGTGCAGCCGAAAGACACGGTTCGGAAGTCGACGGGATCGACAGGCACAATCTCGTACTGC
GCCCCGGAAGTGCTGAAGATGGACGTCGACGGGCGGTACGGAAACTTTACCACCAAGTCGGACATATTCTCCCTC
GGCATGATCCTCTACTTCATGTGCTTCGGTAGGCTGCCATACCAGGGAGCCAACGCCATCCAGGAAGAGCTCGAG
GATATGGAACAGCTCCGGGCCGAGATTGCCGACTGGGAGGGCTTCCAGGACGAGCGACGGGAGAGGCCCGACTTG
CCGACGCGCCTGTACCAGCTGCTAAAGAAGCTGCTGGCCCTAAACCCGGCAGAGCGGCCGAGCGCCAACGAGGTG
CTGACGGCCATGAAGAGCGAGACCAACTTTGGCGGCATCCCGAGGGTCGACAGATCGTCGCCCACTTCGGCGTCG
GGTCCTCGTCGAGTCCAGAACCTGGATTCTCCTGCGGCTCCCGGGACGCCTGTACCGGGTGCTGGTGGTGAGCCG
CCGTCGCCATCCGCCTTGAGCCCCAGGGCTCTTGCTGACTTGGTGGCAGACGCGAGAAAGGAGAGAGGCTGGAGC
CGGTTCGCTGATTCTTGGTCCGAGCCGGACGAGGGAACGGACAGAGCGCCGTCGCTGGAGAGAGAGACGGCGTCG
CAGTCGGTCGCACAGCCTGTCGTCTCGCAGCGTCGCGGTCACGGTCTGCAGCCACTCGCGGCCGAAGATGGTCAC
AGCCGACCCCTATCGGCTTCCGTCTCCACGCCACTTCTAATGGCTCCGCCCCGGAGCAACATGGGAGAGGCGCGG
TATCAGATGCAGATGGCGGCCCATCGTATCGTTCACACGCTGCGCACCGAGAGGCTTCTTACCAGCTTCGCCACC
CGTCTGGCCTTCTTCCTTCTCAAGCTCGGCACGCTGGCCCGTCCCTGCTGGCCCCTGATGGCGAGTCCTCAAGTG
AGCATCCCACTGGTCGTGGTCGCGGCTCTAGACCTGGTTATGTCTACTGCCGACTCGCCCGTTGCGGAACAGAGG
CGAATGCGTGTCAGTCACGGTTCTCTTCCGCCACTGGATTTCTTCTCTACCGAGGCCGTTACGAGCTTGATCCTG
CTTGCTGTTCACTTTGTTGGGCTGTGGCTTGCGAGGAGATGGGGGTCTTTGTGCGTTGCAGCGCTACCTGATGAC
GACTGGGCGCAGTGGTGA
Transcript >Ophun1|626
ATGTCGCTGATCCCGTACCATCCTCGCGAGGACGGTGAGCTCGTCCTGTTCGTCGCTTCGCAGCAGACTGATGGG
GAGGCGTTGAAACTGACTGCTCCTGACTCCAGCCGCCACCAAAACTCGCTCGTCTACCGAAACCCCGACTCCCTC
CGCCTCGAAATCTACCCTCGGGAATGCCCGACCTGTCACCAGCCGCTGGACCGCGCCTCGTCGTCCGAAGACCGG
CACTATGACTTGGACGGGGAATACGTCGATCCGACCTACTTTCGCAAGCTGCGCGCGGGCACAGAGGCTACGATG
CCGCAGGAGGGCGTGCCCAGCCCTGTTCGCAGGCTGTTTCCTGCACTAGCTGGCAGTGGCAGCGGCAGCGGTAGT
GAGGCACAGCCCGTCGACTCTGACACCTATTTTGGCGACGAAGCCGATGACTCGGTCTCGGGCGCGGGCAGCAGG
ATCCGGTCCGAGGCCTTTAGCCCCAACTACTTCAAGACCTTCTTCGTCGAAGAGACGGTTCTTGGCAGAGGCGGC
AAGGGCGTCGTCTTGCTCGTACGACACGAGATCGACGGTTGCCAGCTGGGTCACTTTGCCTGCAAACGCGTCCCC
GTCGGTGACGACCATGGCTGGCTGGAGAAGGTGTTGATCGAGGTCGAGCTCCTCGCCGCTCTATCGCACCCGAAC
CTCGTCTCGTATCGGCATGTGTGGCTCGAAAATGTCCAGCTCACCCGCTTTGGTCCCAGCGTGGCCTGTGCCTTT
ATCCTGCAGCAGTACTGTAACGGGGGCGACCTTCATCAGTACGTCGTGGGTGGCGCGCCCCGTGAGGCCACCAAG
GAGGAGCTCAAGGCCCAGATGCGCCGTCGTTCCAAGGGTCAGGCCGAGCCGCCTCGCGATCTCGCACAGGGCCAG
CTGCAGCTGTCGTTTGAAGACATCTACTCCTTCTTCAGAGATATCACGTTGGGGGTCGCCTACCTACACACCAAC
AACTACATACACCGCGATCTCAAGCCCAGCAACTGCCTGCTCCACAGCGAAGGCGGCAAGCTGAGGTGCCTCATC
AGCGACTTTGGAGAGGTGCAGCCGAAAGACACGGTTCGGAAGTCGACGGGATCGACAGGCACAATCTCGTACTGC
GCCCCGGAAGTGCTGAAGATGGACGTCGACGGGCGGTACGGAAACTTTACCACCAAGTCGGACATATTCTCCCTC
GGCATGATCCTCTACTTCATGTGCTTCGGTAGGCTGCCATACCAGGGAGCCAACGCCATCCAGGAAGAGCTCGAG
GATATGGAACAGCTCCGGGCCGAGATTGCCGACTGGGAGGGCTTCCAGGACGAGCGACGGGAGAGGCCCGACTTG
CCGACGCGCCTGTACCAGCTGCTAAAGAAGCTGCTGGCCCTAAACCCGGCAGAGCGGCCGAGCGCCAACGAGGTG
CTGACGGCCATGAAGAGCGAGACCAACTTTGGCGGCATCCCGAGGGTCGACAGATCGTCGCCCACTTCGGCGTCG
GGTCCTCGTCGAGTCCAGAACCTGGATTCTCCTGCGGCTCCCGGGACGCCTGTACCGGGTGCTGGTGGTGAGCCG
CCGTCGCCATCCGCCTTGAGCCCCAGGGCTCTTGCTGACTTGGTGGCAGACGCGAGAAAGGAGAGAGGCTGGAGC
CGGTTCGCTGATTCTTGGTCCGAGCCGGACGAGGGAACGGACAGAGCGCCGTCGCTGGAGAGAGAGACGGCGTCG
CAGTCGGTCGCACAGCCTGTCGTCTCGCAGCGTCGCGGTCACGGTCTGCAGCCACTCGCGGCCGAAGATGGTCAC
AGCCGACCCCTATCGGCTTCCGTCTCCACGCCACTTCTAATGGCTCCGCCCCGGAGCAACATGGGAGAGGCGCGG
TATCAGATGCAGATGGCGGCCCATCGTATCGTTCACACGCTGCGCACCGAGAGGCTTCTTACCAGCTTCGCCACC
CGTCTGGCCTTCTTCCTTCTCAAGCTCGGCACGCTGGCCCGTCCCTGCTGGCCCCTGATGGCGAGTCCTCAAGTG
AGCATCCCACTGGTCGTGGTCGCGGCTCTAGACCTGGTTATGTCTACTGCCGACTCGCCCGTTGCGGAACAGAGG
CGAATGCGTGTCAGTCACGGTTCTCTTCCGCCACTGGATTTCTTCTCTACCGAGGCCGTTACGAGCTTGATCCTG
CTTGCTGTTCACTTTGTTGGGCTGTGGCTTGCGAGGAGATGGGGGTCTTTGTGCGTTGCAGCGCTACCTGATGAC
GACTGGGCGCAGTGGTGA
Gene >Ophun1|626
ATGTCGCTGATCCCGTACCATCCTCGCGAGGACGGTGAGCTCGTCCTGTTCGTCGCTTCGCAGCAGACTGATGGG
GAGGCGTTGAAACTGACTGCTCCTGACTCCAGCCGCCACCAAAACTCGCTCGTCTACCGAAACCCCGACTCCCTC
CGCCTCGAAATCTACCCTCGGGAATGCCCGACCTGTCACCAGCCGCTGGACCGCGCCTCGTCGTCCGAAGACCGG
CACTATGACTTGGACGGGGAATACGTCGATCCGACCTACTTTCGCAAGCTGCGCGCGGGCACAGAGGCTACGATG
CCGCAGGAGGGCGTGCCCAGCCCTGTTCGCAGGCTGTTTCCTGCACTAGCTGGCAGTGGCAGCGGCAGCGGTAGT
GAGGCACAGCCCGTCGACTCTGACACCTATTTTGGCGACGAAGCCGATGACTCGGTCTCGGGCGCGGGCAGCAGG
ATCCGGTCCGAGGCCTTTAGCCCCAACTACTTCAAGACCTTCTTCGTCGAAGAGACGGTTCTTGGCAGAGGCGGC
AAGGGCGTCGTCTTGCTCGTACGACACGAGATCGACGGTTGCCAGCTGGGTCACTTTGCCTGCAAACGCGTCCCC
GTCGGTGACGACCATGGCTGGCTGGAGAAGGTGTTGATCGAGGTCGAGCTCCTCGCCGCTCTATCGCACCCGAAC
CTCGTCTCGTATCGGCATGTGTGGCTCGAAAATGTCCAGCTCACCCGCTTTGGTCCCAGCGTGGCCTGTGCCTTT
ATCCTGCAGCAGTACTGTAACGGGGGCGACCTTCATCAGTACGTCGTGGGTGGCGCGCCCCGTGAGGCCACCAAG
GAGGAGCTCAAGGCCCAGATGCGCCGTCGTTCCAAGGGTCAGGCCGAGCCGCCTCGCGATCTCGCACAGGGCCAG
CTGCAGCTGTCGTTTGAAGACATCTACTCCTTCTTCAGAGATATCACGTTGGGGGTCGCCTACCTACACACCAAC
AACTACATACACCGCGATCTCAAGCCCAGCAACTGCCTGCTCCACAGCGAAGGCGGCAAGCTGAGGTGCCTCATC
AGCGACTTTGGAGAGGTGCAGCCGAAAGACACGGTTCGGAAGTCGACGGGATCGACAGGCACAATCTCGTACTGC
GCCCCGGAAGTGCTGAAGATGGACGTCGACGGGCGGTACGGAAACTTTACCACCAAGTCGGACATATTCTCCCTC
GGCATGATCCTCTACTTCATGTGCTTCGGTAGGCTGCCATACCAGGGAGCCAACGCCATCCAGGAAGAGCTCGAG
GATATGGAACAGCTCCGGGCCGAGATTGCCGACTGGGAGGGCTTCCAGGACGAGCGACGGGAGAGGCCCGACTTG
CCGACGCGCCTGTACCAGCTGCTAAAGAAGCTGCTGGCCCTAAACCCGGCAGAGCGGCCGAGCGCCAACGAGGTG
CTGACGGCCATGAAGAGCGAGACCAACTTTGGCGGCATCCCGAGGGTCGACAGATCGTCGCCCACTTCGGCGTCG
GGTCCTCGTCGAGTCCAGAACCTGGATTCTCCTGCGGCTCCCGGGACGCCTGTACCGGGTGCTGGTGGTGAGCCG
CCGTCGCCATCCGCCTTGAGCCCCAGGGCTCTTGCTGACTTGGTGGCAGACGCGAGAAAGGAGAGAGGCTGGAGC
CGGTTCGCTGATTCTTGGTCCGAGCCGGACGAGGGAACGGACAGAGCGCCGTCGCTGGAGAGAGAGACGGCGTCG
CAGTCGGTCGCACAGCCTGTCGTCTCGCAGCGTCGCGGTCACGGTCTGCAGCCACTCGCGGCCGAAGATGGTCAC
AGCCGACCCCTATCGGCTTCCGTCTCCACGCCACTTCTAATGGCTCCGCCCCGGAGCAACATGGGAGAGGCGCGG
TATCAGATGCAGATGGCGGCCCATCGTATCGTTCACACGCTGCGCACCGAGAGGCTTCTTACCAGCTTCGCCACC
CGTCTGGCCTTCTTCCTTCTCAAGCTCGGCACGCTGGCCCGTCCCTGCTGGCCCCTGATGGCGAGTCCTCAAGTG
AGCATCCCACTGGTCGTGGTCGCGGCTCTAGACCTGGTTATGTCTACTGCCGACTCGCCCGTTGCGGAACAGAGG
CGAATGCGTGTCAGTCACGGTTCTCTTCCGCCACTGGATTTCTTCTCTACCGAGGCCGTTACGAGCTTGATCCTG
CTTGCTGTTCACTTTGTTGGGCTGTGGCTTGCGAGGAGATGGGGGTCTTTGTGCGTTGCAGCGCTACCTGATGAC
GACTGGGCGCAGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail