Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6259
Gene name
LocationContig_670:2996..7031
Strand-
Gene length (bp)4035
Transcript length (bp)3282
Coding sequence length (bp)3282
Protein length (aa) 1094

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04189 Gcd10p Gcd10p family 7.0E-102 578 918
PF00743 FMO-like Flavin-binding monooxygenase-like 1.9E-18 2 212
PF00743 FMO-like Flavin-binding monooxygenase-like 6.5E-07 371 539
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 4.8E-08 5 209
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.4E-09 1 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WE58|TRM6_ASPFU tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=trm6 PE=3 SV=1 581 1089 3.0E-139
sp|Q2UJ66|TRM6_ASPOR tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=trm6 PE=3 SV=1 580 1089 1.0E-133
sp|Q6CF35|TRM6_YARLI tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM6 PE=3 SV=1 558 1093 7.0E-50
sp|Q5A6Q4|TRM6_CANAL tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM6 PE=3 SV=1 578 1089 3.0E-40
sp|Q6BKK7|TRM6_DEBHA tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRM6 PE=3 SV=2 579 1081 6.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WE58|TRM6_ASPFU tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=trm6 PE=3 SV=1 581 1089 3.0E-139
sp|Q2UJ66|TRM6_ASPOR tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=trm6 PE=3 SV=1 580 1089 1.0E-133
sp|Q6CF35|TRM6_YARLI tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM6 PE=3 SV=1 558 1093 7.0E-50
sp|Q5A6Q4|TRM6_CANAL tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM6 PE=3 SV=1 578 1089 3.0E-40
sp|Q6BKK7|TRM6_DEBHA tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRM6 PE=3 SV=2 579 1081 6.0E-39
sp|Q9HGL4|TRM6_SCHPO tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcd10 PE=3 SV=1 569 1090 1.0E-38
sp|P41814|TRM6_YEAST tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD10 PE=1 SV=1 580 1080 3.0E-31
sp|Q6CLF6|TRM6_KLULA tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRM6 PE=3 SV=1 569 1075 1.0E-30
sp|Q6FNP9|TRM6_CANGA tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRM6 PE=3 SV=1 568 1067 9.0E-29
sp|Q75B32|TRM6_ASHGO tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRM6 PE=3 SV=1 569 1077 9.0E-26
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 2 217 2.0E-17
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 2 217 3.0E-17
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 2 217 6.0E-17
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 2 217 8.0E-17
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 2 217 1.0E-16
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 2 217 4.0E-16
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 2 217 5.0E-16
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 2 210 5.0E-16
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 2 217 6.0E-16
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 2 210 5.0E-15
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 2 192 8.0E-15
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 2 210 3.0E-14
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 2 210 4.0E-14
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 2 192 1.0E-13
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 2 195 2.0E-13
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 2 195 2.0E-13
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 2 210 2.0E-13
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 2 192 2.0E-13
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 2 192 4.0E-13
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 2 195 6.0E-13
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 2 210 8.0E-13
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 2 210 1.0E-12
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 2 210 1.0E-12
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 2 210 2.0E-12
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 2 195 2.0E-12
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 2 210 6.0E-12
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 2 210 6.0E-12
sp|P0CS06|TRM6_CRYNJ tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRM6 PE=3 SV=1 884 1089 9.0E-12
sp|P0CS07|TRM6_CRYNB tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRM6 PE=3 SV=1 884 1089 9.0E-12
sp|P0CS06|TRM6_CRYNJ tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRM6 PE=3 SV=1 581 788 2.0E-11
sp|P0CS07|TRM6_CRYNB tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRM6 PE=3 SV=1 581 788 2.0E-11
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 2 210 2.0E-11
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 2 173 2.0E-10
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 2 210 5.0E-10
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 4 192 1.0E-08
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 4 205 2.0E-08
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 2 210 3.0E-08
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 4 198 4.0E-08
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 2 210 6.0E-08
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 371 539 8.0E-08
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 371 539 1.0E-07
sp|Q9FKE7|FMO2_ARATH Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=2 2 192 1.0E-07
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 2 210 4.0E-07
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 2 210 4.0E-07
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 3 202 6.0E-07
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 4 209 2.0E-06
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 3 248 3.0E-06
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 3 192 3.0E-06
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 4 216 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031515 tRNA (m1A) methyltransferase complex Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0030488 tRNA methylation Yes
GO:0043167 ion binding No
GO:0034708 methyltransferase complex No
GO:0001510 RNA methylation No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:1902494 catalytic complex No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0032259 methylation No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0004497 monooxygenase activity No
GO:0006807 nitrogen compound metabolic process No
GO:1990234 transferase complex No
GO:0006399 tRNA metabolic process No
GO:0043527 tRNA methyltransferase complex No
GO:0016070 RNA metabolic process No
GO:0009451 RNA modification No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043414 macromolecule methylation No
GO:0034470 ncRNA processing No
GO:0005488 binding No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0008033 tRNA processing No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043412 macromolecule modification No
GO:0006400 tRNA modification No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup950
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2786
Ophiocordyceps australis map64 (Brazil) OphauB2|2822
Ophiocordyceps camponoti-floridani Ophcf2|03701
Ophiocordyceps camponoti-rufipedis Ophun1|6259 (this protein)
Ophiocordyceps kimflemingae Ophio5|5773
Ophiocordyceps subramaniannii Hirsu2|705
Ophiocordyceps subramaniannii Hirsu2|9428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6259
MKVAVVGGGPGGLTTLKFLRTAHEFFPIQPIEARLFEAEDRIGGTFVYRVYEDAELVSSKYLTAFSDFRLPDDAP
DFVTPQAYVAYLTAYVEAFRLGDSIECRTRVTGIERGPLGVGHVVTMVKGDGREIRWECDAVAVCSGLHVHPSIP
YIEGMERVPMVLHSSRLKRREQFGRDTNVVVCGAGETAMDVAHLAVTSPTASVTICHRDGWFCAPKIIPTPRPQR
RNAPVRPNKPVDTSVASLFDTAYVHPTLQRSRLLWFAYDQWVKKMHLLISGTEEGPDQWKGHISRDRKNLDSIFL
CKSDRALPYISQGHRSTWWLNRLRSSIINVPLADTQGRSIDVMRWPTHVDADGFMHMTEDDGQTPRRFRPDVVIM
ATGYTPDFAFLGAHYPRPGQADVRGVYKSDDITVAFIGFVRPAIGAIPPLAELQAQLWVLRLLQTRFPTSMPRIG
ADRDAVPAYELDYRLQPRCGYDFFSSKGGVDHEAYAYQLALDMGAAPKATYVARKGWRLLFVWALGSNFNPKFRL
VGPWRWEAGAEAIMRGELFSVVRRSGGLLYLMTYTLIPFAVFGSISLVLYAWTGTISLGKYGSFPSNLLIERPFH
LTYEVQERRQGESFSRLRIVPGTELNADLLAADNDDYDELALVDEAAGRMPPQDEDDDPGGSTRQTLTTAEIEHL
KRRGADAGKELIAKLMLSHTALDQKSAFSLAKYRLLKEKKFLRRFTILPVDVPLLARWMLEVREPAKILDMRLEL
IGLVSCWADVHFGGADGRWLAVDDTGGLLVAAMAESMGILHRRSVAGGDGKEDGDDKVKPVDSVATDETMTPNKN
HAHPRKRPRRDDLDDHYASGNTITLLHANSQPNLSLLRYFDYDASDPNPPAPHHPLFTHLLPLSWLQLVSPESDP
AYAERPPDVPAEELAAWKPNRRGNYFRKRRRWARTRQVVEGARTGGFSGLAVASTMDPVSVLRHALPLLAGGSPI
AVYSPHIEPLTKLADCFTIARRAAWLSSPPADAEGRTQAELERWTGTAEFPLNPTLVLGATVHTSRAKRWQVLPG
RTHPYMTARGGSDGYVFTGWRAIPAEGRVSARGKFQKKKACGG*
Coding >Ophun1|6259
ATGAAGGTCGCAGTCGTAGGCGGCGGCCCAGGCGGCCTAACAACCCTCAAATTCCTCCGCACCGCCCACGAATTC
TTCCCGATCCAGCCCATCGAAGCCCGTCTTTTCGAAGCCGAGGACCGCATTGGCGGAACCTTTGTCTATCGCGTG
TACGAAGACGCCGAGCTCGTCTCATCCAAGTATCTCACGGCCTTTTCAGACTTTCGCCTTCCGGATGACGCGCCG
GATTTCGTCACGCCGCAGGCTTACGTCGCGTATCTGACCGCCTATGTCGAGGCTTTTCGACTGGGCGATTCCATC
GAGTGTCGGACGCGAGTGACGGGCATTGAAAGGGGTCCGCTGGGCGTCGGACACGTGGTAACCATGGTCAAAGGA
GACGGGCGTGAAATCCGCTGGGAATGTGATGCCGTCGCCGTCTGCTCTGGGCTTCACGTCCATCCATCGATTCCG
TATATCGAGGGTATGGAGAGGGTGCCCATGGTGCTGCACTCGTCTCGTCTCAAGCGACGGGAACAATTCGGTCGT
GACACCAATGTCGTTGTCTGTGGAGCGGGAGAGACGGCTATGGATGTGGCTCATCTGGCTGTGACATCACCTACA
GCCTCCGTCACCATCTGTCATCGTGATGGATGGTTCTGCGCGCCAAAGATTATACCGACTCCTCGACCGCAAAGA
CGAAACGCCCCGGTGAGACCGAATAAACCCGTCGACACATCCGTTGCCAGTCTCTTTGATACGGCTTATGTGCAT
CCCACGCTGCAGCGGAGTAGACTGCTGTGGTTTGCGTACGATCAGTGGGTTAAGAAGATGCACTTGCTCATCTCC
GGCACAGAGGAGGGCCCGGATCAGTGGAAAGGCCACATCAGCCGCGACCGCAAGAATCTCGACTCGATCTTCCTC
TGCAAGTCAGACCGAGCCCTCCCCTACATCTCCCAAGGCCATCGTTCGACATGGTGGTTGAACCGGCTGAGAAGC
AGCATCATCAACGTCCCCCTCGCCGATACCCAAGGCCGAAGCATCGACGTCATGAGATGGCCGACTCACGTAGAC
GCCGATGGCTTCATGCACATGACAGAAGACGACGGCCAAACACCACGAAGATTCCGGCCGGATGTCGTCATCATG
GCCACCGGCTACACTCCCGACTTTGCCTTTCTCGGAGCCCATTATCCTCGTCCAGGCCAGGCCGACGTCCGGGGC
GTGTACAAGAGCGACGACATCACCGTGGCCTTTATCGGCTTCGTCCGGCCTGCCATCGGCGCCATCCCACCTCTC
GCCGAGTTACAAGCCCAGCTCTGGGTTCTCCGTCTCCTCCAGACGCGCTTCCCAACCTCGATGCCTCGAATAGGC
GCGGACCGCGACGCAGTACCGGCCTACGAGCTCGACTACCGACTCCAGCCGCGGTGCGGATACGACTTCTTCTCC
AGCAAAGGCGGCGTCGATCACGAGGCGTATGCCTACCAGCTCGCACTCGACATGGGCGCCGCTCCCAAGGCGACG
TACGTGGCTCGCAAGGGGTGGCGTCTCTTGTTCGTCTGGGCGCTGGGCTCCAACTTTAACCCCAAGTTTCGTCTC
GTCGGGCCGTGGCGGTGGGAGGCCGGGGCTGAGGCCATCATGCGCGGCGAGTTGTTTTCCGTCGTGCGGCGCTCG
GGCGGTCTCTTGTACTTGATGACTTACACGTTGATTCCCTTTGCCGTCTTTGGCTCCATCAGCCTTGTTTTGTAT
GCTTGGACTGGGACAATCTCCCTCGGCAAATACGGCTCCTTCCCGAGCAACCTGCTGATAGAGCGGCCCTTTCAT
CTGACGTACGAAGTCCAAGAGCGGCGCCAAGGCGAGTCCTTTTCACGACTGCGCATCGTTCCGGGCACGGAGCTC
AACGCCGACCTCTTGGCCGCCGATAACGATGACTACGACGAATTGGCGCTGGTGGACGAAGCTGCTGGTCGCATG
CCGCCGCAAGACGAAGACGATGACCCGGGAGGTTCCACGCGACAGACGCTGACGACGGCTGAGATTGAGCATCTC
AAGCGACGGGGCGCCGACGCGGGAAAGGAGCTCATCGCCAAGCTCATGCTTTCCCACACGGCTCTCGATCAAAAG
TCCGCCTTCTCGCTGGCCAAGTATCGGCTCCTCAAGGAGAAGAAGTTCCTGCGTCGGTTCACCATCTTGCCCGTC
GATGTACCGCTGCTGGCCCGCTGGATGCTCGAGGTTCGCGAGCCGGCCAAGATTCTCGATATGCGGCTTGAGCTC
ATCGGGCTCGTCTCCTGCTGGGCTGATGTTCACTTTGGCGGTGCTGATGGGAGGTGGTTGGCTGTTGATGATACG
GGGGGTTTGCTGGTGGCTGCCATGGCTGAGTCGATGGGGATTTTGCATCGGCGTTCGGTGGCTGGGGGTGACGGG
AAGGAGGACGGTGACGACAAGGTCAAGCCAGTCGACAGCGTCGCAACTGACGAGACGATGACCCCCAATAAGAAT
CACGCCCACCCTCGCAAACGTCCCCGACGCGACGACCTCGACGACCACTACGCCTCCGGAAACACAATCACCCTC
CTCCACGCAAACTCACAGCCCAACCTCTCCCTCCTCCGCTACTTCGACTACGACGCCAGCGACCCCAACCCTCCA
GCCCCTCACCACCCGCTCTTCACCCACCTCCTCCCCCTATCCTGGCTCCAACTCGTCAGTCCCGAAAGCGACCCA
GCCTACGCCGAGCGCCCACCCGACGTCCCGGCCGAAGAACTCGCCGCATGGAAACCCAACCGACGCGGCAACTAC
TTCCGGAAGCGCCGCCGCTGGGCCCGCACCAGACAGGTGGTAGAGGGCGCACGCACGGGCGGCTTCAGCGGCCTG
GCCGTCGCCAGCACCATGGATCCCGTCTCCGTCCTCCGGCACGCGCTTCCCCTGCTGGCCGGCGGGAGTCCCATC
GCCGTCTACTCGCCGCACATCGAGCCGCTGACCAAGCTGGCCGATTGCTTCACCATCGCCCGTCGCGCCGCCTGG
CTCTCCTCGCCGCCCGCCGACGCCGAGGGCCGGACGCAGGCCGAGTTGGAGCGCTGGACGGGGACGGCCGAGTTT
CCTCTCAACCCGACGCTCGTCTTGGGCGCGACGGTGCACACCAGTCGGGCTAAGCGGTGGCAGGTCCTTCCGGGA
CGGACGCACCCGTACATGACGGCCCGTGGCGGCTCCGACGGCTACGTCTTTACCGGCTGGCGGGCGATTCCGGCC
GAGGGGAGGGTCTCGGCGAGAGGCAAGTTTCAGAAGAAGAAGGCGTGCGGCGGATGA
Transcript >Ophun1|6259
ATGAAGGTCGCAGTCGTAGGCGGCGGCCCAGGCGGCCTAACAACCCTCAAATTCCTCCGCACCGCCCACGAATTC
TTCCCGATCCAGCCCATCGAAGCCCGTCTTTTCGAAGCCGAGGACCGCATTGGCGGAACCTTTGTCTATCGCGTG
TACGAAGACGCCGAGCTCGTCTCATCCAAGTATCTCACGGCCTTTTCAGACTTTCGCCTTCCGGATGACGCGCCG
GATTTCGTCACGCCGCAGGCTTACGTCGCGTATCTGACCGCCTATGTCGAGGCTTTTCGACTGGGCGATTCCATC
GAGTGTCGGACGCGAGTGACGGGCATTGAAAGGGGTCCGCTGGGCGTCGGACACGTGGTAACCATGGTCAAAGGA
GACGGGCGTGAAATCCGCTGGGAATGTGATGCCGTCGCCGTCTGCTCTGGGCTTCACGTCCATCCATCGATTCCG
TATATCGAGGGTATGGAGAGGGTGCCCATGGTGCTGCACTCGTCTCGTCTCAAGCGACGGGAACAATTCGGTCGT
GACACCAATGTCGTTGTCTGTGGAGCGGGAGAGACGGCTATGGATGTGGCTCATCTGGCTGTGACATCACCTACA
GCCTCCGTCACCATCTGTCATCGTGATGGATGGTTCTGCGCGCCAAAGATTATACCGACTCCTCGACCGCAAAGA
CGAAACGCCCCGGTGAGACCGAATAAACCCGTCGACACATCCGTTGCCAGTCTCTTTGATACGGCTTATGTGCAT
CCCACGCTGCAGCGGAGTAGACTGCTGTGGTTTGCGTACGATCAGTGGGTTAAGAAGATGCACTTGCTCATCTCC
GGCACAGAGGAGGGCCCGGATCAGTGGAAAGGCCACATCAGCCGCGACCGCAAGAATCTCGACTCGATCTTCCTC
TGCAAGTCAGACCGAGCCCTCCCCTACATCTCCCAAGGCCATCGTTCGACATGGTGGTTGAACCGGCTGAGAAGC
AGCATCATCAACGTCCCCCTCGCCGATACCCAAGGCCGAAGCATCGACGTCATGAGATGGCCGACTCACGTAGAC
GCCGATGGCTTCATGCACATGACAGAAGACGACGGCCAAACACCACGAAGATTCCGGCCGGATGTCGTCATCATG
GCCACCGGCTACACTCCCGACTTTGCCTTTCTCGGAGCCCATTATCCTCGTCCAGGCCAGGCCGACGTCCGGGGC
GTGTACAAGAGCGACGACATCACCGTGGCCTTTATCGGCTTCGTCCGGCCTGCCATCGGCGCCATCCCACCTCTC
GCCGAGTTACAAGCCCAGCTCTGGGTTCTCCGTCTCCTCCAGACGCGCTTCCCAACCTCGATGCCTCGAATAGGC
GCGGACCGCGACGCAGTACCGGCCTACGAGCTCGACTACCGACTCCAGCCGCGGTGCGGATACGACTTCTTCTCC
AGCAAAGGCGGCGTCGATCACGAGGCGTATGCCTACCAGCTCGCACTCGACATGGGCGCCGCTCCCAAGGCGACG
TACGTGGCTCGCAAGGGGTGGCGTCTCTTGTTCGTCTGGGCGCTGGGCTCCAACTTTAACCCCAAGTTTCGTCTC
GTCGGGCCGTGGCGGTGGGAGGCCGGGGCTGAGGCCATCATGCGCGGCGAGTTGTTTTCCGTCGTGCGGCGCTCG
GGCGGTCTCTTGTACTTGATGACTTACACGTTGATTCCCTTTGCCGTCTTTGGCTCCATCAGCCTTGTTTTGTAT
GCTTGGACTGGGACAATCTCCCTCGGCAAATACGGCTCCTTCCCGAGCAACCTGCTGATAGAGCGGCCCTTTCAT
CTGACGTACGAAGTCCAAGAGCGGCGCCAAGGCGAGTCCTTTTCACGACTGCGCATCGTTCCGGGCACGGAGCTC
AACGCCGACCTCTTGGCCGCCGATAACGATGACTACGACGAATTGGCGCTGGTGGACGAAGCTGCTGGTCGCATG
CCGCCGCAAGACGAAGACGATGACCCGGGAGGTTCCACGCGACAGACGCTGACGACGGCTGAGATTGAGCATCTC
AAGCGACGGGGCGCCGACGCGGGAAAGGAGCTCATCGCCAAGCTCATGCTTTCCCACACGGCTCTCGATCAAAAG
TCCGCCTTCTCGCTGGCCAAGTATCGGCTCCTCAAGGAGAAGAAGTTCCTGCGTCGGTTCACCATCTTGCCCGTC
GATGTACCGCTGCTGGCCCGCTGGATGCTCGAGGTTCGCGAGCCGGCCAAGATTCTCGATATGCGGCTTGAGCTC
ATCGGGCTCGTCTCCTGCTGGGCTGATGTTCACTTTGGCGGTGCTGATGGGAGGTGGTTGGCTGTTGATGATACG
GGGGGTTTGCTGGTGGCTGCCATGGCTGAGTCGATGGGGATTTTGCATCGGCGTTCGGTGGCTGGGGGTGACGGG
AAGGAGGACGGTGACGACAAGGTCAAGCCAGTCGACAGCGTCGCAACTGACGAGACGATGACCCCCAATAAGAAT
CACGCCCACCCTCGCAAACGTCCCCGACGCGACGACCTCGACGACCACTACGCCTCCGGAAACACAATCACCCTC
CTCCACGCAAACTCACAGCCCAACCTCTCCCTCCTCCGCTACTTCGACTACGACGCCAGCGACCCCAACCCTCCA
GCCCCTCACCACCCGCTCTTCACCCACCTCCTCCCCCTATCCTGGCTCCAACTCGTCAGTCCCGAAAGCGACCCA
GCCTACGCCGAGCGCCCACCCGACGTCCCGGCCGAAGAACTCGCCGCATGGAAACCCAACCGACGCGGCAACTAC
TTCCGGAAGCGCCGCCGCTGGGCCCGCACCAGACAGGTGGTAGAGGGCGCACGCACGGGCGGCTTCAGCGGCCTG
GCCGTCGCCAGCACCATGGATCCCGTCTCCGTCCTCCGGCACGCGCTTCCCCTGCTGGCCGGCGGGAGTCCCATC
GCCGTCTACTCGCCGCACATCGAGCCGCTGACCAAGCTGGCCGATTGCTTCACCATCGCCCGTCGCGCCGCCTGG
CTCTCCTCGCCGCCCGCCGACGCCGAGGGCCGGACGCAGGCCGAGTTGGAGCGCTGGACGGGGACGGCCGAGTTT
CCTCTCAACCCGACGCTCGTCTTGGGCGCGACGGTGCACACCAGTCGGGCTAAGCGGTGGCAGGTCCTTCCGGGA
CGGACGCACCCGTACATGACGGCCCGTGGCGGCTCCGACGGCTACGTCTTTACCGGCTGGCGGGCGATTCCGGCC
GAGGGGAGGGTCTCGGCGAGAGGCAAGTTTCAGAAGAAGAAGGCGTGCGGCGGATGA
Gene >Ophun1|6259
ATGAAGGTCGCAGTCGTAGGCGGCGGCCCAGGCGGCCTAACAACCCTCAAATTCCTCCGCACCGCCCACGAATTC
TTCCCGATCCAGCCCATCGAAGCCCGTCTTTTCGAAGCCGAGGACCGCATTGGCGGAACCTTTGTCTATCGCGTG
TACGAAGACGCCGAGGTGAGTGTCGTGTCTGAGCTCACGGCTTCTTGTATTGATAGGGATTGCGCAGCTCGTCTC
ATCCAAGTATCTCACGGCCTTTTCAGACTTTCGCCTTCCGGATGACGCGCCGGATTTCGTCACGCCGCAGGCTTA
CGTCGCGTATCTGACCGCCTATGTCGAGGCTTTTCGACTGGGCGATTCCATCGAGTGTCGGACGCGAGTGACGGG
CATTGAAAGGGGTCCGCTGGGCGTCGGACACGTGGTAACCATGGTCAAAGGAGACGGGCGTGAAATCCGCTGGGA
ATGTGATGCCGTCGCCGTCTGCTCTGGGCTTCACGTCCATCCATCGATTCCGTATATCGAGGGTATGGAGAGGGT
GCCCATGGTGCTGCACTCGTCTCGTCTCAAGCGACGGGAACAATTCGGTCGTGACACCAATGTCGTTGTCTGTGG
AGCGGGAGAGACGGCTATGGATGTGGCTCATCTGGCTGTGACATCACCTACAGCCTCCGTCACCATCTGTCATCG
TGATGGATGGTTCTGCGCGCCAAAGGTAAGTTGATGGAGGAGAGACAAGAGGAGTGTTTCTGACTGACGTCGATA
GATTATACCGACTCCTCGACCGCAAAGACGAAACGCCCCGGTGAGACCGAATAAACCCGTCGACACATCCGTTGC
CAGTCTCTTTGATACGGCTTATGTGCATCCCACGCTGCAGCGGAGTAGACTGCTGTGGTTTGCGTACGATCAGTG
GGTTAAGAAGATGCACTTGCTCATCTCCGGCACAGAGGAGGGCCCGGATCAGTGGAAAGGCCACATCAGCCGCGA
CCGCAAGAATCTCGACTCGAGTGAGTGGCTCCTCATACCTTGTACACATATATACAGGGGGAAATCGAAGGATAA
GAGCTCACTACAGCTGCCAGTCTTCCTCTGCAAGTCAGACCGAGCCCTCCCCTACATCTCCCAAGGCCATCGTTC
GACATGGTGGTTGAACCGGCTGAGAAGCAGCATCATCAACGTCCCCCTCGCCGATACCCAAGGCCGAAGCATCGA
CGTCATGAGATGGCCGACTCACGTAGACGCCGATGGCTTCATGCACATGACAGAAGACGACGGCCAAACACCACG
AAGATTCCGGCCGGATGTCGTCATCATGGCCACCGGCTACACTCCCGACTTTGCCTTTCTCGGAGCCCATTATCC
TCGTCCAGGCCAGGCCGACGTCCGGGGCGTGTACAAGAGCGACGACATCACCGTGGCCTTTATCGGCTTCGTCCG
GCCTGCCATCGGCGCCATCCCACCTCTCGCCGAGTTACAAGCCCAGCTCTGGGTTCTCCGTCTCCTCCAGACGCG
CTTCCCAACCTCGATGCCTCGAATAGGCGCGGACCGCGACGCAGTACCGGCCTACGAGCTCGACTACCGACTCCA
GCCGCGGTGCGGATACGACTTCTTCTCCAGCAAAGGCGGCGTCGATCACGAGGCGTATGCCTACCAGCTCGCACT
CGACATGGGCGCCGCTCCCAAGGCGACGTACGTGGCTCGCAAGGGGTGGCGTCTCTTGTTCGTCTGGGCGCTGGG
CTCCAACTTTAACCCCAAGTTTCGTCTCGTCGGGCCGTGGCGGTGGGAGGCCGGGGCTGAGGCCATCATGCGCGG
CGAGTTGTTTTCCGTCGTGCGGCGCTCGGGCGGTCTCTTGTGTGAGTATCTCGAAGGGGTTGGAGGCGAGTTGCG
CTGACGGCTTGGTAGACTTGATGACTTACACGTTGATTCCCTTTGCCGTCTTTGGCTCCATCAGCCTTGTTTTGT
ATGCTTGGACTGGGTTTGTCGGTGTGTTGGCGGGGGCTGTGCGGGTGGTTTTGAGGCGGCCTCGGAAGAAGCAGT
GAAGTGAAGTTGGGTGGAAGCAGAGAGATAGATAGGTGAAGCTGGGTTGGGCTCGGTCAGGCTCGGTGAGCTCGG
TGAGCTCGGTGAGTGGGACAGACACGACGTCGAGTATCGGATGCATCATGTATGAGTCACTGGCACAGGCGTCTT
CTCTCGATGTAGAATTGGAGCTATACCTGTAGCCGTGACCCTTCTTATCCCGTGAATCAAGCCCGTGATGATGCT
CACTCGAGGTGGACTCGCAGCACGTGACTCTCTGCAGGGCATAACCCTGGTCAACCTTGAAGCTCGACAACCATC
ACGGAACCAACAAGTGACACCTGCTGATGGCCGCTCGCAACTCGGTCCAGCCCCACGGCTGGGCGGCGCTGAAGC
TCCCCAACGAGACACTGCGCGTGCTTCAGGTGACGCCAAATACGTGAGAGCGAAGCCCGCACCGCTCCTCCAACC
ACTGACCGAACCAGGACAATCTCCCTCGGCAAATACGGCTCCTTCCCGAGCAACCTGCTGATAGAGCGGCCCTTT
CATCTGACGTACGAAGTCCAAGAGCGGCGCCAAGGCGAGTCCTTTTCACGACTGCGCATCGTTCCGGGCACGGAG
CTCAACGCCGACCTCTTGGCCGCCGATAACGATGACTACGACGAATTGGCGCTGGTGGACGAAGCTGCTGGTCGC
ATGCCGCCGCAAGACGAAGACGATGACCCGGGAGGTTCCACGCGACAGACGCTGACGACGGCTGAGATTGAGCAT
CTCAAGCGACGGGGCGCCGACGCGGGAAAGGAGCTCATCGCCAAGCTCATGCTTTCCCACACGGCTCTCGATCAA
AAGTCCGCCTTCTCGCTGGCCAAGTATCGGCTCCTCAAGGAGAAGAAGTTCCTGCGTCGGTTCACCATCTTGCCC
GTCGATGTACCGCTGCTGGCCCGCTGGATGCTCGAGGTTCGCGAGCCGGCCAAGATTCTCGATATGCGGCTTGAG
CTCATCGGGCTCGTCTCCTGCTGGGCTGATGTTCACTTTGGCGGTGCTGATGGGAGGTGGTTGGCTGTTGATGAT
ACGGGGGGTTTGCTGGTGGCTGCCATGGCTGAGTCGATGGGGATTTTGCATCGGCGTTCGGTGGCTGGGGGTGAC
GGGAAGGAGGACGGTGACGACAAGGTCAAGCCAGTCGACAGCGTCGCAACTGACGAGACGATGACCCCCAATAAG
AATCACGCCCACCCTCGCAAACGTCCCCGACGCGACGACCTCGACGACCACTACGCCTCCGGAAACACAATCACC
CTCCTCCACGCAAACTCACAGCCCAACCTCTCCCTCCTCCGCTACTTCGACTACGACGCCAGCGACCCCAACCCT
CCAGCCCCTCACCACCCGCTCTTCACCCACCTCCTCCCCCTATCCTGGCTCCAACTCGTCAGTCCCGAAAGCGAC
CCAGCCTACGCCGAGCGCCCACCCGACGTCCCGGCCGAAGAACTCGCCGCATGGAAACCCAACCGACGCGGCAAC
TACTTCCGGAAGCGCCGCCGCTGGGCCCGCACCAGACAGGTGGTAGAGGGCGCACGCACGGGCGGCTTCAGCGGC
CTGGCCGTCGCCAGCACCATGGATCCCGTCTCCGTCCTCCGGCACGCGCTTCCCCTGCTGGCCGGCGGGAGTCCC
ATCGCCGTCTACTCGCCGCACATCGAGCCGCTGACCAAGCTGGCCGATTGCTTCACCATCGCCCGTCGCGCCGCC
TGGCTCTCCTCGCCGCCCGCCGACGCCGAGGGCCGGACGCAGGCCGAGTTGGAGCGCTGGACGGGGACGGCCGAG
TTTCCTCTCAACCCGACGCTCGTCTTGGGCGCGACGGTGCACACCAGTCGGGCTAAGCGGTGGCAGGTCCTTCCG
GGACGGACGCACCCGTACATGACGGCCCGTGGCGGCTCCGACGGCTACGTCTTTACCGGCTGGCGGGCGATTCCG
GCCGAGGGGAGGGTCTCGGCGAGAGGCAAGTTTCAGAAGAAGAAGGCGTGCGGCGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail