Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6249
Gene name
LocationContig_67:33043..33604
Strand+
Gene length (bp)561
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00203 Ribosomal_S19 Ribosomal protein S19 8.4E-29 50 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34737|RS15_PODAS 40S ribosomal protein S15 OS=Podospora anserina GN=RPS15 PE=3 SV=1 1 129 5.0E-83
sp|Q945U1|RS15_ELAOL 40S ribosomal protein S15 OS=Elaeis oleifera GN=RPS15 PE=2 SV=1 1 129 4.0E-59
sp|O65059|RS15_PICMA 40S ribosomal protein S15 OS=Picea mariana GN=RPS15 PE=2 SV=1 15 129 6.0E-57
sp|P31674|RS15_ORYSJ 40S ribosomal protein S15 OS=Oryza sativa subsp. japonica GN=RPS15 PE=2 SV=2 1 129 2.0E-56
sp|Q9FY65|RS153_ARATH 40S ribosomal protein S15-3 OS=Arabidopsis thaliana GN=RPS15C PE=2 SV=1 1 129 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34737|RS15_PODAS 40S ribosomal protein S15 OS=Podospora anserina GN=RPS15 PE=3 SV=1 1 129 5.0E-83
sp|Q945U1|RS15_ELAOL 40S ribosomal protein S15 OS=Elaeis oleifera GN=RPS15 PE=2 SV=1 1 129 4.0E-59
sp|O65059|RS15_PICMA 40S ribosomal protein S15 OS=Picea mariana GN=RPS15 PE=2 SV=1 15 129 6.0E-57
sp|P31674|RS15_ORYSJ 40S ribosomal protein S15 OS=Oryza sativa subsp. japonica GN=RPS15 PE=2 SV=2 1 129 2.0E-56
sp|Q9FY65|RS153_ARATH 40S ribosomal protein S15-3 OS=Arabidopsis thaliana GN=RPS15C PE=2 SV=1 1 129 1.0E-54
sp|Q9FY66|RS152_ARATH 40S ribosomal protein S15-2 OS=Arabidopsis thaliana GN=RPS15B PE=2 SV=1 1 129 2.0E-53
sp|O94715|RS15A_SCHPO 40S ribosomal protein S15-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1501 PE=3 SV=1 1 129 7.0E-53
sp|Q9UTQ6|RS15B_SCHPO 40S ribosomal protein S15-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1502 PE=1 SV=1 1 129 3.0E-52
sp|Q9FY64|RS154_ARATH 40S ribosomal protein S15-4 OS=Arabidopsis thaliana GN=RPS15D PE=2 SV=1 1 129 7.0E-50
sp|Q08112|RS151_ARATH 40S ribosomal protein S15-1 OS=Arabidopsis thaliana GN=RPS15A PE=2 SV=1 1 129 1.0E-49
sp|Q9FIX6|RS155_ARATH 40S ribosomal protein S15-5 OS=Arabidopsis thaliana GN=RPS15E PE=3 SV=1 10 129 2.0E-47
sp|P62845|RS15_RAT 40S ribosomal protein S15 OS=Rattus norvegicus GN=Rps15 PE=1 SV=2 11 129 8.0E-47
sp|Q5RDI7|RS15_PONAB 40S ribosomal protein S15 OS=Pongo abelii GN=RPS15 PE=2 SV=3 11 129 8.0E-47
sp|P62844|RS15_PIG 40S ribosomal protein S15 OS=Sus scrofa GN=RPS15 PE=1 SV=2 11 129 8.0E-47
sp|P62843|RS15_MOUSE 40S ribosomal protein S15 OS=Mus musculus GN=Rps15 PE=1 SV=2 11 129 8.0E-47
sp|P62842|RS15_MESAU 40S ribosomal protein S15 OS=Mesocricetus auratus GN=RPS15 PE=2 SV=2 11 129 8.0E-47
sp|P62841|RS15_HUMAN 40S ribosomal protein S15 OS=Homo sapiens GN=RPS15 PE=1 SV=2 11 129 8.0E-47
sp|P62846|RS15_CHICK 40S ribosomal protein S15 OS=Gallus gallus GN=RPS15 PE=2 SV=2 11 129 8.0E-47
sp|Q56K10|RS15_BOVIN 40S ribosomal protein S15 OS=Bos taurus GN=RPS15 PE=2 SV=3 11 129 4.0E-46
sp|P70066|RS15_XIPMA 40S ribosomal protein S15 OS=Xiphophorus maculatus GN=rps15 PE=2 SV=1 11 129 4.0E-46
sp|Q01855|RS15_YEAST 40S ribosomal protein S15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS15 PE=1 SV=1 15 129 9.0E-45
sp|Q9FML6|RS156_ARATH 40S ribosomal protein S15-6 OS=Arabidopsis thaliana GN=RPS15F PE=2 SV=1 7 129 1.0E-44
sp|Q9XVP0|RS15_CAEEL 40S ribosomal protein S15 OS=Caenorhabditis elegans GN=rps-15 PE=1 SV=3 1 129 2.0E-43
sp|P20342|RS15_XENLA 40S ribosomal protein S15 OS=Xenopus laevis GN=rps15 PE=2 SV=3 24 129 3.0E-39
sp|Q54N17|RS15_DICDI 40S ribosomal protein S15 OS=Dictyostelium discoideum GN=rps15 PE=3 SV=1 11 129 1.0E-32
sp|A3DNB1|RS19_STAMF 30S ribosomal protein S19 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps19 PE=3 SV=1 10 127 7.0E-29
sp|A2BMB3|RS19_HYPBU 30S ribosomal protein S19 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps19 PE=3 SV=2 19 127 3.0E-28
sp|Q975I5|RS19_SULTO 30S ribosomal protein S19 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps19 PE=3 SV=1 19 129 3.0E-26
sp|O26114|RS19_METTH 30S ribosomal protein S19 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps19 PE=3 SV=1 18 127 4.0E-26
sp|C5A282|RS19_THEGJ 30S ribosomal protein S19 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps19 PE=3 SV=1 20 129 4.0E-26
sp|P15010|RS19_HALSA 30S ribosomal protein S19 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps19 PE=3 SV=2 21 129 4.0E-26
sp|B0R660|RS19_HALS3 30S ribosomal protein S19 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps19 PE=3 SV=1 21 129 4.0E-26
sp|A5UL85|RS19_METS3 30S ribosomal protein S19 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps19 PE=3 SV=1 22 127 7.0E-26
sp|Q9V1T9|RS19_PYRAB 30S ribosomal protein S19 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps19 PE=3 SV=1 18 127 7.0E-26
sp|Q5JDH3|RS19_THEKO 30S ribosomal protein S19 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps19 PE=3 SV=1 20 129 2.0E-25
sp|O59422|RS19_PYRHO 30S ribosomal protein S19 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps19 PE=3 SV=1 18 127 2.0E-25
sp|Q9YF74|RS19_AERPE 30S ribosomal protein S19 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps19 PE=3 SV=3 16 127 3.0E-25
sp|Q8U002|RS19_PYRFU 30S ribosomal protein S19 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps19 PE=1 SV=1 18 127 3.0E-25
sp|P51429|RS15_NAEGR 40S ribosomal protein S15 (Fragment) OS=Naegleria gruberi GN=RPS15 PE=2 SV=1 33 129 4.0E-25
sp|Q4JB44|RS19_SULAC 30S ribosomal protein S19 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps19 PE=3 SV=1 19 129 8.0E-25
sp|P20284|RS19_HALMA 30S ribosomal protein S19 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps19 PE=1 SV=4 21 129 8.0E-25
sp|Q9UXA3|RS19_SULSO 30S ribosomal protein S19 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps19 PE=3 SV=1 19 129 1.0E-24
sp|A8AA18|RS19_IGNH4 30S ribosomal protein S19 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps19 PE=3 SV=1 18 127 1.0E-24
sp|A1RWQ5|RS19_THEPD 30S ribosomal protein S19 OS=Thermofilum pendens (strain Hrk 5) GN=rps19 PE=3 SV=1 21 129 2.0E-24
sp|Q8TWP2|RS19_METKA 30S ribosomal protein S19 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps19 PE=3 SV=1 1 127 3.0E-24
sp|P54018|RS19_METJA 30S ribosomal protein S19 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps19 PE=3 SV=1 22 129 4.0E-24
sp|A4YCX0|RS19_METS5 30S ribosomal protein S19 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps19 PE=3 SV=1 19 128 4.0E-24
sp|B6YSL7|RS19_THEON 30S ribosomal protein S19 OS=Thermococcus onnurineus (strain NA1) GN=rps19 PE=3 SV=1 20 129 4.0E-24
sp|Q3IMY4|RS19_NATPD 30S ribosomal protein S19 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps19 PE=3 SV=1 21 129 7.0E-24
sp|A7I5P3|RS19_METB6 30S ribosomal protein S19 OS=Methanoregula boonei (strain 6A8) GN=rps19 PE=3 SV=1 22 129 8.0E-24
sp|Q2NFW0|RS19_METST 30S ribosomal protein S19 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps19 PE=3 SV=1 22 127 1.0E-23
sp|B1L708|RS19_KORCO 30S ribosomal protein S19 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps19 PE=3 SV=1 20 129 2.0E-23
sp|B9LSS3|RS19_HALLT 30S ribosomal protein S19 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rps19 PE=3 SV=1 10 129 3.0E-23
sp|O28358|RS19_ARCFU 30S ribosomal protein S19 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps19 PE=3 SV=1 20 129 3.0E-23
sp|Q8ZWL4|RS19_PYRAE 30S ribosomal protein S19 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps19 PE=3 SV=1 19 129 5.0E-23
sp|A4WIZ3|RS19_PYRAR 30S ribosomal protein S19 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps19 PE=3 SV=1 19 129 5.0E-23
sp|A1RV74|RS19_PYRIL 30S ribosomal protein S19 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps19 PE=3 SV=1 19 129 2.0E-22
sp|C6A163|RS19_THESM 30S ribosomal protein S19 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps19 PE=3 SV=1 20 129 2.0E-22
sp|A3CT01|RS19_METMJ 30S ribosomal protein S19 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps19 PE=3 SV=1 21 129 3.0E-22
sp|B1YD00|RS19_PYRNV 30S ribosomal protein S19 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps19 PE=3 SV=1 19 129 3.0E-22
sp|Q18GF3|RS19_HALWD 30S ribosomal protein S19 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps19 PE=3 SV=1 21 129 1.0E-21
sp|A3MTT6|RS19_PYRCJ 30S ribosomal protein S19 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps19 PE=3 SV=1 19 129 2.0E-21
sp|Q0W1Y5|RS19_METAR 30S ribosomal protein S19 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps19 PE=3 SV=1 6 129 5.0E-21
sp|A0RVX7|RS19_CENSY 30S ribosomal protein S19 OS=Cenarchaeum symbiosum (strain A) GN=rps19 PE=3 SV=1 20 129 1.0E-20
sp|A6UV64|RS19_META3 30S ribosomal protein S19 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps19 PE=3 SV=1 22 129 2.0E-20
sp|A9A5J1|RS19_NITMS 30S ribosomal protein S19 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps19 PE=3 SV=1 20 129 4.0E-20
sp|Q97BX3|RS19_THEVO 30S ribosomal protein S19 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps19 PE=3 SV=1 20 129 6.0E-20
sp|A6VHD6|RS19_METM7 30S ribosomal protein S19 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps19 PE=3 SV=1 2 127 6.0E-20
sp|A0B9W6|RS19_METTP 30S ribosomal protein S19 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps19 PE=3 SV=1 22 129 8.0E-20
sp|A9A9B4|RS19_METM6 30S ribosomal protein S19 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps19 PE=3 SV=1 2 127 2.0E-19
sp|Q12ZU7|RS19_METBU 30S ribosomal protein S19 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps19 PE=3 SV=1 10 127 3.0E-19
sp|A4FVX8|RS19_METM5 30S ribosomal protein S19 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps19 PE=3 SV=1 22 127 5.0E-19
sp|A6UQJ4|RS19_METVS 30S ribosomal protein S19 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps19 PE=3 SV=1 22 127 7.0E-19
sp|Q6LX07|RS19_METMP 30S ribosomal protein S19 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps19 PE=3 SV=1 22 127 9.0E-19
sp|Q2FT35|RS19_METHJ 30S ribosomal protein S19 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps19 PE=3 SV=1 21 129 2.0E-18
sp|A8MC54|RS19_CALMQ 30S ribosomal protein S19 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps19 PE=3 SV=1 19 129 3.0E-18
sp|Q6L1C3|RS19_PICTO 30S ribosomal protein S19 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps19 PE=3 SV=1 20 129 3.0E-18
sp|Q8PV46|RS19_METMA 30S ribosomal protein S19 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps19 PE=3 SV=1 10 127 5.0E-18
sp|Q9HIR3|RS19_THEAC 30S ribosomal protein S19 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps19 PE=3 SV=1 20 129 6.0E-18
sp|A2SPK7|RS19_METLZ 30S ribosomal protein S19 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps19 PE=3 SV=1 13 129 8.0E-17
sp|Q8TRU3|RS19_METAC 30S ribosomal protein S19 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps19 PE=3 SV=1 10 127 8.0E-17
sp|Q46G99|RS19_METBF 30S ribosomal protein S19 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps19 PE=3 SV=1 10 127 9.0E-17
sp|Q74MZ5|RS19_NANEQ 30S ribosomal protein S19 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps19 PE=3 SV=1 20 129 1.0E-15
sp|Q6B8V7|RR19_GRATL 30S ribosomal protein S19, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rps19 PE=3 SV=1 52 126 4.0E-09
sp|C0QQM7|RS19_PERMH 30S ribosomal protein S19 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsS PE=3 SV=1 63 129 6.0E-09
sp|P59776|RR19_CHLRE 30S ribosomal protein S19, chloroplastic OS=Chlamydomonas reinhardtii GN=rps19 PE=1 SV=1 52 127 9.0E-09
sp|Q87E78|RS19_XYLFT 30S ribosomal protein S19 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsS PE=3 SV=1 63 129 1.0E-08
sp|B2I8H3|RS19_XYLF2 30S ribosomal protein S19 OS=Xylella fastidiosa (strain M23) GN=rpsS PE=3 SV=1 63 129 1.0E-08
sp|A6LLL7|RS19_THEM4 30S ribosomal protein S19 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsS PE=3 SV=1 52 129 1.0E-08
sp|B0U5K3|RS19_XYLFM 30S ribosomal protein S19 OS=Xylella fastidiosa (strain M12) GN=rpsS PE=3 SV=1 63 129 1.0E-08
sp|A9NED7|RS19_ACHLI 30S ribosomal protein S19 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsS PE=3 SV=1 54 127 2.0E-08
sp|Q8R7V8|RS19_CALS4 30S ribosomal protein S19 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsS PE=3 SV=1 52 127 2.0E-08
sp|O46898|RR19_GUITH 30S ribosomal protein S19, chloroplastic OS=Guillardia theta GN=rps19 PE=3 SV=1 78 127 2.0E-08
sp|Q6F1Z0|RS19_MESFL 30S ribosomal protein S19 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsS PE=3 SV=1 54 127 2.0E-08
sp|A5FMZ6|RS19_FLAJ1 30S ribosomal protein S19 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpsS PE=3 SV=1 54 127 3.0E-08
sp|B9MKH7|RS19_CALBD 30S ribosomal protein S19 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsS PE=3 SV=1 52 127 4.0E-08
sp|Q9PE72|RS19_XYLFA 30S ribosomal protein S19 OS=Xylella fastidiosa (strain 9a5c) GN=rpsS PE=3 SV=1 63 129 4.0E-08
sp|P19170|RR19_EUGGR 30S ribosomal protein S19, chloroplastic OS=Euglena gracilis GN=rps19 PE=3 SV=1 52 126 4.0E-08
sp|Q8DMM7|RS19_THEEB 30S ribosomal protein S19 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsS PE=3 SV=1 52 127 4.0E-08
sp|A4XLS6|RS19_CALS8 30S ribosomal protein S19 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsS PE=3 SV=1 52 127 4.0E-08
sp|Q83ES0|RS19_COXBU 30S ribosomal protein S19 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsS PE=3 SV=1 63 129 4.0E-08
sp|A9NAM8|RS19_COXBR 30S ribosomal protein S19 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsS PE=3 SV=1 63 129 4.0E-08
sp|A9KD27|RS19_COXBN 30S ribosomal protein S19 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsS PE=3 SV=1 63 129 4.0E-08
sp|B6J259|RS19_COXB2 30S ribosomal protein S19 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpsS PE=3 SV=1 63 129 4.0E-08
sp|B6J5D6|RS19_COXB1 30S ribosomal protein S19 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpsS PE=3 SV=1 63 129 4.0E-08
sp|B2V7K9|RS19_SULSY 30S ribosomal protein S19 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsS PE=3 SV=1 82 129 5.0E-08
sp|B7IHV0|RS19_THEAB 30S ribosomal protein S19 OS=Thermosipho africanus (strain TCF52B) GN=rpsS PE=3 SV=1 52 129 5.0E-08
sp|C4L7T4|RS19_TOLAT 30S ribosomal protein S19 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsS PE=3 SV=1 54 127 5.0E-08
sp|P10132|RS19_MYCCT 30S ribosomal protein S19 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsS PE=3 SV=1 54 127 6.0E-08
sp|A4GGF9|RR19_PHAVU 30S ribosomal protein S19, chloroplastic OS=Phaseolus vulgaris GN=rps19 PE=3 SV=1 52 127 6.0E-08
sp|Q8LUX2|RR19_PHAAN 30S ribosomal protein S19, chloroplastic OS=Phaseolus angularis GN=rps19 PE=3 SV=1 52 127 6.0E-08
sp|P07816|RR19_SOYBN 30S ribosomal protein S19, chloroplastic OS=Glycine max GN=rps19 PE=3 SV=3 52 127 7.0E-08
sp|A0T0I2|RR19_PHATC 30S ribosomal protein S19, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps19 PE=3 SV=1 54 126 7.0E-08
sp|Q6MSM9|RS19_MYCMS 30S ribosomal protein S19 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpsS PE=3 SV=1 54 127 7.0E-08
sp|Q31IX8|RS19_THICR 30S ribosomal protein S19 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsS PE=3 SV=1 54 129 9.0E-08
sp|A6MW05|RR19_RHDSA 30S ribosomal protein S19, chloroplastic OS=Rhodomonas salina GN=rps19 PE=3 SV=1 52 127 1.0E-07
sp|B5RM40|RS19_BORDL 30S ribosomal protein S19 OS=Borrelia duttonii (strain Ly) GN=rpsS PE=3 SV=1 54 127 1.0E-07
sp|B8D845|RS19_BUCAT 30S ribosomal protein S19 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsS PE=3 SV=1 54 129 1.0E-07
sp|P57587|RS19_BUCAI 30S ribosomal protein S19 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsS PE=3 SV=1 54 129 1.0E-07
sp|B8D9U3|RS19_BUCA5 30S ribosomal protein S19 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsS PE=3 SV=1 54 129 1.0E-07
sp|Q4FLM2|RS19_PELUB 30S ribosomal protein S19 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsS PE=3 SV=1 63 127 1.0E-07
sp|Q9RXJ8|RS19_DEIRA 30S ribosomal protein S19 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsS PE=3 SV=1 54 127 1.0E-07
sp|B8D0C8|RS19_HALOH 30S ribosomal protein S19 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsS PE=3 SV=1 52 127 1.0E-07
sp|Q8K954|RS19_BUCAP 30S ribosomal protein S19 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsS PE=3 SV=1 54 129 1.0E-07
sp|A0T0X6|RR19_THAPS 30S ribosomal protein S19, chloroplastic OS=Thalassiosira pseudonana GN=rps19 PE=3 SV=1 52 126 1.0E-07
sp|B0K5P7|RS19_THEPX 30S ribosomal protein S19 OS=Thermoanaerobacter sp. (strain X514) GN=rpsS PE=3 SV=1 52 127 1.0E-07
sp|B0KCK4|RS19_THEP3 30S ribosomal protein S19 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsS PE=3 SV=1 52 127 1.0E-07
sp|B7J247|RS19_BORBZ 30S ribosomal protein S19 OS=Borrelia burgdorferi (strain ZS7) GN=rpsS PE=3 SV=1 54 127 1.0E-07
sp|P94271|RS19_BORBU 30S ribosomal protein S19 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsS PE=3 SV=2 54 127 1.0E-07
sp|Q661D8|RS19_BORBP 30S ribosomal protein S19 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsS PE=3 SV=1 54 127 1.0E-07
sp|Q0SN25|RS19_BORAP 30S ribosomal protein S19 OS=Borrelia afzelii (strain PKo) GN=rpsS PE=3 SV=1 54 127 1.0E-07
sp|A1TJ11|RS19_ACIAC 30S ribosomal protein S19 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsS PE=3 SV=1 52 129 1.0E-07
sp|B5RPI6|RS19_BORRA 30S ribosomal protein S19 OS=Borrelia recurrentis (strain A1) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|A1S222|RS19_SHEAM 30S ribosomal protein S19 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|B8I7Y3|RS19_CLOCE 30S ribosomal protein S19 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsS PE=3 SV=1 52 127 2.0E-07
sp|A6GZ95|RS19_FLAPJ 30S ribosomal protein S19 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|A1QZR8|RS19_BORT9 30S ribosomal protein S19 OS=Borrelia turicatae (strain 91E135) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|B2S0I5|RS19_BORHD 30S ribosomal protein S19 OS=Borrelia hermsii (strain HS1 / DAH) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|A0A376|RR19_COFAR 30S ribosomal protein S19, chloroplastic OS=Coffea arabica GN=rps19 PE=3 SV=1 52 127 2.0E-07
sp|A4GYV1|RR19_POPTR 30S ribosomal protein S19, chloroplastic OS=Populus trichocarpa GN=rps19-1 PE=3 SV=1 52 127 2.0E-07
sp|Q14F94|RR19_POPAL 30S ribosomal protein S19, chloroplastic OS=Populus alba GN=rps19 PE=3 SV=1 52 127 2.0E-07
sp|A7Y3J1|RR19_IPOPU 30S ribosomal protein S19, chloroplastic OS=Ipomoea purpurea GN=rps19 PE=3 SV=1 54 127 2.0E-07
sp|B8E1D7|RS19_DICTD 30S ribosomal protein S19 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsS PE=3 SV=1 52 127 2.0E-07
sp|A0M594|RS19_GRAFK 30S ribosomal protein S19 OS=Gramella forsetii (strain KT0803) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|A1AVK4|RS19_RUTMC 30S ribosomal protein S19 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsS PE=3 SV=1 54 129 2.0E-07
sp|A8GYY0|RS19_SHEPA 30S ribosomal protein S19 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|A3Q986|RS19_SHELP 30S ribosomal protein S19 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|B0TM08|RS19_SHEHH 30S ribosomal protein S19 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsS PE=3 SV=2 54 127 2.0E-07
sp|A1W2R1|RS19_ACISJ 30S ribosomal protein S19 OS=Acidovorax sp. (strain JS42) GN=rpsS PE=3 SV=1 52 129 2.0E-07
sp|B9MB77|RS19_ACIET 30S ribosomal protein S19 OS=Acidovorax ebreus (strain TPSY) GN=rpsS PE=3 SV=1 52 129 2.0E-07
sp|Q6LVB2|RS19_PHOPR 30S ribosomal protein S19 OS=Photobacterium profundum GN=rpsS PE=3 SV=1 54 127 2.0E-07
sp|B5YDU7|RS19_DICT6 30S ribosomal protein S19 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsS PE=3 SV=1 52 127 2.0E-07
sp|A1WHC9|RS19_VEREI 30S ribosomal protein S19 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsS PE=3 SV=1 52 129 2.0E-07
sp|B1KMX9|RS19_SHEWM 30S ribosomal protein S19 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A1REB8|RS19_SHESW 30S ribosomal protein S19 OS=Shewanella sp. (strain W3-18-1) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|Q0I0A1|RS19_SHESR 30S ribosomal protein S19 OS=Shewanella sp. (strain MR-7) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|Q0HNT3|RS19_SHESM 30S ribosomal protein S19 OS=Shewanella sp. (strain MR-4) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A8G1E4|RS19_SHESH 30S ribosomal protein S19 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A0KRM8|RS19_SHESA 30S ribosomal protein S19 OS=Shewanella sp. (strain ANA-3) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|B8CND7|RS19_SHEPW 30S ribosomal protein S19 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A4YBX9|RS19_SHEPC 30S ribosomal protein S19 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|Q8EK64|RS19_SHEON 30S ribosomal protein S19 OS=Shewanella oneidensis (strain MR-1) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|Q089Q0|RS19_SHEFN 30S ribosomal protein S19 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|Q12SV5|RS19_SHEDO 30S ribosomal protein S19 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A9KWA6|RS19_SHEB9 30S ribosomal protein S19 OS=Shewanella baltica (strain OS195) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A6WHT2|RS19_SHEB8 30S ribosomal protein S19 OS=Shewanella baltica (strain OS185) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A3DA68|RS19_SHEB5 30S ribosomal protein S19 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|B8EBK1|RS19_SHEB2 30S ribosomal protein S19 OS=Shewanella baltica (strain OS223) GN=rpsS PE=3 SV=1 54 127 3.0E-07
sp|A5CXK8|RS19_VESOH 30S ribosomal protein S19 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsS PE=3 SV=1 54 129 3.0E-07
sp|B0U0Y5|RS19_FRAP2 30S ribosomal protein S19 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpsS PE=3 SV=1 54 129 3.0E-07
sp|Q73PM8|RS19_TREDE 30S ribosomal protein S19 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsS PE=3 SV=1 52 127 3.0E-07
sp|Q9Z7R1|RS19_CHLPN 30S ribosomal protein S19 OS=Chlamydia pneumoniae GN=rpsS PE=3 SV=2 52 127 3.0E-07
sp|A9BPS2|RS19_DELAS 30S ribosomal protein S19 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsS PE=3 SV=1 52 129 3.0E-07
sp|Q0ZIX8|RR19_VITVI 30S ribosomal protein S19, chloroplastic OS=Vitis vinifera GN=rps19 PE=3 SV=1 52 127 3.0E-07
sp|A8MLE4|RS19_ALKOO 30S ribosomal protein S19 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsS PE=3 SV=1 52 129 3.0E-07
sp|Q2JIM3|RS19_SYNJB 30S ribosomal protein S19 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsS PE=3 SV=1 52 126 3.0E-07
sp|B2FQ49|RS19_STRMK 30S ribosomal protein S19 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsS PE=3 SV=1 54 129 4.0E-07
sp|Q110B1|RS19_TRIEI 30S ribosomal protein S19 OS=Trichodesmium erythraeum (strain IMS101) GN=rpsS PE=3 SV=1 52 127 4.0E-07
sp|P67900|RS19_PASMU 30S ribosomal protein S19 OS=Pasteurella multocida (strain Pm70) GN=rpsS PE=3 SV=2 54 127 4.0E-07
sp|Q65QV9|RS19_MANSM 30S ribosomal protein S19 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|B0UX17|RS19_HISS2 30S ribosomal protein S19 OS=Histophilus somni (strain 2336) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|Q0I159|RS19_HAES1 30S ribosomal protein S19 OS=Haemophilus somnus (strain 129Pt) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|B8F759|RS19_HAEPS 30S ribosomal protein S19 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|P67899|RS19_HAEIN 30S ribosomal protein S19 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsS PE=3 SV=2 54 127 4.0E-07
sp|A5UHT4|RS19_HAEIG 30S ribosomal protein S19 OS=Haemophilus influenzae (strain PittGG) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|A5UDU3|RS19_HAEIE 30S ribosomal protein S19 OS=Haemophilus influenzae (strain PittEE) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|Q4QMB8|RS19_HAEI8 30S ribosomal protein S19 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|P67898|RS19_HAEDU 30S ribosomal protein S19 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsS PE=3 SV=2 54 127 4.0E-07
sp|P67897|RS19_AGGAC 30S ribosomal protein S19 OS=Aggregatibacter actinomycetemcomitans GN=rpsS PE=3 SV=2 54 127 4.0E-07
sp|A6VLJ2|RS19_ACTSZ 30S ribosomal protein S19 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|B0BST5|RS19_ACTPJ 30S ribosomal protein S19 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|B3GZ15|RS19_ACTP7 30S ribosomal protein S19 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|A3N362|RS19_ACTP2 30S ribosomal protein S19 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|Q6XYY2|RS19_SPIKU 30S ribosomal protein S19 OS=Spiroplasma kunkelii GN=rpsS PE=3 SV=1 52 127 4.0E-07
sp|B9LJD6|RS19_CHLSY 30S ribosomal protein S19 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsS PE=3 SV=1 52 127 4.0E-07
sp|A9WH70|RS19_CHLAA 30S ribosomal protein S19 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsS PE=3 SV=2 52 127 4.0E-07
sp|A4ST02|RS19_AERS4 30S ribosomal protein S19 OS=Aeromonas salmonicida (strain A449) GN=rpsS PE=3 SV=2 54 127 4.0E-07
sp|A0KF25|RS19_AERHH 30S ribosomal protein S19 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|Q9BBP7|RR19_LOTJA 30S ribosomal protein S19, chloroplastic OS=Lotus japonicus GN=rps19 PE=3 SV=1 52 127 4.0E-07
sp|Q83FZ0|RS19_TROWT 30S ribosomal protein S19 OS=Tropheryma whipplei (strain Twist) GN=rpsS PE=3 SV=2 54 127 4.0E-07
sp|Q83I74|RS19_TROW8 30S ribosomal protein S19 OS=Tropheryma whipplei (strain TW08/27) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|P80381|RS19_THETH 30S ribosomal protein S19 OS=Thermus thermophilus GN=rpsS PE=1 SV=3 82 127 4.0E-07
sp|Q5SHP2|RS19_THET8 30S ribosomal protein S19 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsS PE=1 SV=3 82 127 4.0E-07
sp|P62660|RS19_THET2 30S ribosomal protein S19 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsS PE=1 SV=2 82 127 4.0E-07
sp|A5GVW4|RS19_SYNR3 30S ribosomal protein S19 OS=Synechococcus sp. (strain RCC307) GN=rpsS PE=3 SV=1 52 127 4.0E-07
sp|P06508|RR19_SPIOL 30S ribosomal protein S19 alpha, chloroplastic OS=Spinacia oleracea GN=rps19 PE=1 SV=4 52 127 4.0E-07
sp|Q4AAE4|RS19_MYCHJ 30S ribosomal protein S19 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|Q4A8H5|RS19_MYCH7 30S ribosomal protein S19 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|Q601L1|RS19_MYCH2 30S ribosomal protein S19 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsS PE=3 SV=1 54 127 4.0E-07
sp|Q03EC0|RS19_PEDPA 30S ribosomal protein S19 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsS PE=3 SV=1 52 126 5.0E-07
sp|C1CXG2|RS19_DEIDV 30S ribosomal protein S19 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsS PE=3 SV=1 77 127 5.0E-07
sp|Q33BZ1|RR19_NICTO 30S ribosomal protein S19, chloroplastic OS=Nicotiana tomentosiformis GN=rps19 PE=3 SV=1 52 127 5.0E-07
sp|B1NWJ0|RR19_MANES 30S ribosomal protein S19, chloroplastic OS=Manihot esculenta GN=rps19 PE=3 SV=1 52 127 5.0E-07
sp|C5CGR0|RS19_KOSOT 30S ribosomal protein S19 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsS PE=3 SV=1 52 127 5.0E-07
sp|C0QW00|RS19_BRAHW 30S ribosomal protein S19 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rpsS PE=3 SV=1 52 127 5.0E-07
sp|Q2N9B5|RS19_ERYLH 30S ribosomal protein S19 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsS PE=3 SV=1 54 127 5.0E-07
sp|Q1ISB8|RS19_KORVE 30S ribosomal protein S19 OS=Koribacter versatilis (strain Ellin345) GN=rpsS PE=3 SV=1 77 129 5.0E-07
sp|Q68RW6|RR19_PANGI 30S ribosomal protein S19, chloroplastic OS=Panax ginseng GN=rps19 PE=3 SV=1 52 127 5.0E-07
sp|B2G8X4|RS19_LACRJ 30S ribosomal protein S19 OS=Lactobacillus reuteri (strain JCM 1112) GN=rpsS PE=3 SV=1 52 126 5.0E-07
sp|A5VLK1|RS19_LACRD 30S ribosomal protein S19 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsS PE=3 SV=1 52 126 5.0E-07
sp|Q057A8|RS19_BUCCC 30S ribosomal protein S19 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsS PE=3 SV=1 54 129 5.0E-07
sp|Q15YN5|RS19_PSEA6 30S ribosomal protein S19 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsS PE=3 SV=1 54 127 5.0E-07
sp|A8G758|RS19_PROM2 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9215) GN=rpsS PE=3 SV=1 52 127 6.0E-07
sp|Q487Z7|RS19_COLP3 30S ribosomal protein S19 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsS PE=3 SV=1 54 127 6.0E-07
sp|Q38UR6|RS19_LACSS 30S ribosomal protein S19 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsS PE=3 SV=1 52 126 6.0E-07
sp|Q7TU27|RS19_PROMP 30S ribosomal protein S19 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpsS PE=3 SV=1 52 127 6.0E-07
sp|Q0G9S1|RR19_DAUCA 30S ribosomal protein S19, chloroplastic OS=Daucus carota GN=rps19 PE=3 SV=1 52 127 6.0E-07
sp|Q5L716|RS19_CHLAB 30S ribosomal protein S19 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsS PE=3 SV=1 52 127 6.0E-07
sp|Q1IX76|RS19_DEIGD 30S ribosomal protein S19 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsS PE=3 SV=1 54 127 6.0E-07
sp|Q87T09|RS19_VIBPA 30S ribosomal protein S19 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsS PE=3 SV=1 54 127 6.0E-07
sp|A4QLN4|RR19_LOBMA 30S ribosomal protein S19, chloroplastic OS=Lobularia maritima GN=rps19 PE=3 SV=1 52 127 6.0E-07
sp|Q5GWT8|RS19_XANOR 30S ribosomal protein S19 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsS PE=3 SV=1 54 129 6.0E-07
sp|B2SQR4|RS19_XANOP 30S ribosomal protein S19 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsS PE=3 SV=1 54 129 6.0E-07
sp|Q2NZY9|RS19_XANOM 30S ribosomal protein S19 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsS PE=3 SV=1 54 129 6.0E-07
sp|Q8PC45|RS19_XANCP 30S ribosomal protein S19 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsS PE=3 SV=1 54 129 6.0E-07
sp|B0RU78|RS19_XANCB 30S ribosomal protein S19 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsS PE=3 SV=1 54 129 6.0E-07
sp|Q4URE3|RS19_XANC8 30S ribosomal protein S19 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsS PE=3 SV=1 54 129 6.0E-07
sp|Q3A9S0|RS19_CARHZ 30S ribosomal protein S19 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsS PE=3 SV=1 52 127 6.0E-07
sp|A7HM48|RS19_FERNB 30S ribosomal protein S19 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsS PE=3 SV=1 63 129 7.0E-07
sp|A2BYT2|RS19_PROM5 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9515) GN=rpsS PE=3 SV=1 52 127 7.0E-07
sp|Q1R0H1|RS19_CHRSD 30S ribosomal protein S19 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsS PE=3 SV=1 54 129 7.0E-07
sp|A2BTD3|RS19_PROMS 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain AS9601) GN=rpsS PE=3 SV=1 52 127 7.0E-07
sp|A3PF43|RS19_PROM0 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsS PE=3 SV=1 52 127 7.0E-07
sp|A1WVB8|RS19_HALHL 30S ribosomal protein S19 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsS PE=3 SV=1 67 129 7.0E-07
sp|P02376|RR19_TOBAC 30S ribosomal protein S19, chloroplastic OS=Nicotiana tabacum GN=rps19 PE=3 SV=3 52 127 7.0E-07
sp|Q27S09|RR19_SOLTU 30S ribosomal protein S19, chloroplastic OS=Solanum tuberosum GN=rps19 PE=3 SV=1 52 127 7.0E-07
sp|Q2MI60|RR19_SOLLC 30S ribosomal protein S19, chloroplastic OS=Solanum lycopersicum GN=rps19 PE=3 SV=1 52 127 7.0E-07
sp|Q2MIE7|RR19_SOLBU 30S ribosomal protein S19, chloroplastic OS=Solanum bulbocastanum GN=rps19 PE=3 SV=1 52 127 7.0E-07
sp|Q3C1N7|RR19_NICSY 30S ribosomal protein S19, chloroplastic OS=Nicotiana sylvestris GN=rps19 PE=3 SV=1 52 127 7.0E-07
sp|Q7FNS1|RR19_ATRBE 30S ribosomal protein S19, chloroplastic OS=Atropa belladonna GN=rps19 PE=3 SV=1 52 127 7.0E-07
sp|B4U748|RS19_HYDS0 30S ribosomal protein S19 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpsS PE=3 SV=1 82 127 7.0E-07
sp|B3WAL3|RS19_LACCB 30S ribosomal protein S19 OS=Lactobacillus casei (strain BL23) GN=rpsS PE=3 SV=1 52 126 7.0E-07
sp|Q034Y7|RS19_LACC3 30S ribosomal protein S19 OS=Lactobacillus casei (strain ATCC 334) GN=rpsS PE=3 SV=1 52 126 7.0E-07
sp|P47401|RS19_MYCGE 30S ribosomal protein S19 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsS PE=3 SV=1 63 127 7.0E-07
sp|Q0SQE8|RS19_CLOPS 30S ribosomal protein S19 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsS PE=3 SV=1 52 129 7.0E-07
sp|Q8XHS7|RS19_CLOPE 30S ribosomal protein S19 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsS PE=3 SV=1 52 129 7.0E-07
sp|Q0TMQ0|RS19_CLOP1 30S ribosomal protein S19 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsS PE=3 SV=1 52 129 7.0E-07
sp|Q49KV8|RR19_EUCGG 30S ribosomal protein S19, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rps19 PE=3 SV=1 52 127 7.0E-07
sp|Q3BWX9|RS19_XANC5 30S ribosomal protein S19 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsS PE=3 SV=1 54 129 8.0E-07
sp|Q8PNS0|RS19_XANAC 30S ribosomal protein S19 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsS PE=3 SV=1 54 129 8.0E-07
sp|B2XWR4|RR19_FAGEA 30S ribosomal protein S19, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale GN=rps19 PE=3 SV=1 52 127 8.0E-07
sp|Q09G05|RR19_PLAOC 30S ribosomal protein S19, chloroplastic OS=Platanus occidentalis GN=rps19 PE=3 SV=1 52 127 8.0E-07
sp|Q7U4J6|RS19_SYNPX 30S ribosomal protein S19 OS=Synechococcus sp. (strain WH8102) GN=rpsS PE=3 SV=1 52 127 8.0E-07
sp|B5LMR2|RR19_CICAR 30S ribosomal protein S19, chloroplastic OS=Cicer arietinum GN=rps19 PE=3 SV=1 52 127 8.0E-07
sp|Q67JU7|RS19_SYMTH 30S ribosomal protein S19 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsS PE=3 SV=1 77 127 8.0E-07
sp|C3LRQ4|RS19_VIBCM 30S ribosomal protein S19 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsS PE=3 SV=1 54 127 8.0E-07
sp|Q9KNY8|RS19_VIBCH 30S ribosomal protein S19 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsS PE=3 SV=1 54 127 8.0E-07
sp|A5F545|RS19_VIBC3 30S ribosomal protein S19 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsS PE=3 SV=1 54 127 8.0E-07
sp|P73316|RS19_SYNY3 30S ribosomal protein S19 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsS PE=3 SV=1 52 127 9.0E-07
sp|B1WQR4|RS19_CYAA5 30S ribosomal protein S19 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsS PE=3 SV=1 52 127 9.0E-07
sp|B7K331|RS19_CYAP8 30S ribosomal protein S19 OS=Cyanothece sp. (strain PCC 8801) GN=rpsS PE=3 SV=1 52 127 9.0E-07
sp|Q03PW1|RS19_LACBA 30S ribosomal protein S19 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsS PE=3 SV=1 52 126 9.0E-07
sp|B7VLF3|RS19_VIBTL 30S ribosomal protein S19 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsS PE=3 SV=1 54 127 9.0E-07
sp|Q4A5C5|RS19_MYCS5 30S ribosomal protein S19 OS=Mycoplasma synoviae (strain 53) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|Q1MPQ9|RS19_LAWIP 30S ribosomal protein S19 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|B2A4E3|RS19_NATTJ 30S ribosomal protein S19 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|A0ALW4|RS19_LISW6 30S ribosomal protein S19 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|P66484|RS19_LISMO 30S ribosomal protein S19 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|B8DB12|RS19_LISMH 30S ribosomal protein S19 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q71WF0|RS19_LISMF 30S ribosomal protein S19 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|C1KZH6|RS19_LISMC 30S ribosomal protein S19 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|P66485|RS19_LISIN 30S ribosomal protein S19 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|A6MMP8|RR19_DIOEL 30S ribosomal protein S19, chloroplastic OS=Dioscorea elephantipes GN=rps19 PE=3 SV=1 52 127 1.0E-06
sp|A1TYK1|RS19_MARHV 30S ribosomal protein S19 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|Q824P7|RS19_CHLCV 30S ribosomal protein S19 OS=Chlamydophila caviae (strain GPIC) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q21RW2|RS19_RHOFT 30S ribosomal protein S19 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsS PE=3 SV=1 52 129 1.0E-06
sp|P31162|RR19_PEA 30S ribosomal protein S19, chloroplastic OS=Pisum sativum GN=rps19 PE=3 SV=2 52 127 1.0E-06
sp|A7MWI7|RS19_VIBCB 30S ribosomal protein S19 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|B5XJ40|RS19_STRPZ 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q2JV85|RS19_SYNJA 30S ribosomal protein S19 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsS PE=3 SV=1 52 126 1.0E-06
sp|B1Y8I3|RS19_LEPCP 30S ribosomal protein S19 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsS PE=3 SV=1 52 129 1.0E-06
sp|Q318I8|RS19_PROM9 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q0VSJ9|RS19_ALCBS 30S ribosomal protein S19 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|Q72NG5|RS19_LEPIC 30S ribosomal protein S19 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|Q7MPI4|RS19_VIBVY 30S ribosomal protein S19 OS=Vibrio vulnificus (strain YJ016) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|Q8DE43|RS19_VIBVU 30S ribosomal protein S19 OS=Vibrio vulnificus (strain CMCP6) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|A6T3K0|RS19_JANMA 30S ribosomal protein S19 OS=Janthinobacterium sp. (strain Marseille) GN=rpsS PE=3 SV=1 52 129 1.0E-06
sp|A4G9T4|RS19_HERAR 30S ribosomal protein S19 OS=Herminiimonas arsenicoxydans GN=rpsS PE=3 SV=1 52 129 1.0E-06
sp|B2GDW5|RS19_LACF3 30S ribosomal protein S19 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpsS PE=3 SV=1 52 126 1.0E-06
sp|Q2S3R0|RS19_SALRD 30S ribosomal protein S19 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|Q2G8X6|RS19_NOVAD 30S ribosomal protein S19 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|Q0BYB8|RS19_HYPNA 30S ribosomal protein S19 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsS PE=3 SV=1 67 127 1.0E-06
sp|B1A975|RR19_CARPA 30S ribosomal protein S19, chloroplastic OS=Carica papaya GN=rps19 PE=3 SV=1 52 127 1.0E-06
sp|B2KEL7|RS19_ELUMP 30S ribosomal protein S19 OS=Elusimicrobium minutum (strain Pei191) GN=rpsS PE=3 SV=1 52 129 1.0E-06
sp|Q03IF5|RS19_STRTD 30S ribosomal protein S19 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q5FM86|RS19_LACAC 30S ribosomal protein S19 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsS PE=3 SV=2 52 126 1.0E-06
sp|Q9XD32|RS19_LEPIN 30S ribosomal protein S19 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|Q055E0|RS19_LEPBL 30S ribosomal protein S19 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpsS1 PE=3 SV=1 54 127 1.0E-06
sp|Q04PU2|RS19_LEPBJ 30S ribosomal protein S19 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|B4F1I8|RS19_PROMH 30S ribosomal protein S19 OS=Proteus mirabilis (strain HI4320) GN=rpsS PE=3 SV=1 54 127 1.0E-06
sp|A9BHA1|RS19_PETMO 30S ribosomal protein S19 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q252V7|RS19_CHLFF 30S ribosomal protein S19 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|B1I1J2|RS19_DESAP 30S ribosomal protein S19 OS=Desulforudis audaxviator (strain MP104C) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|A5GIU1|RS19_SYNPW 30S ribosomal protein S19 OS=Synechococcus sp. (strain WH7803) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|C5CP49|RS19_VARPS 30S ribosomal protein S19 OS=Variovorax paradoxus (strain S110) GN=rpsS PE=3 SV=1 52 129 1.0E-06
sp|P51310|RR19_PORPU 30S ribosomal protein S19, chloroplastic OS=Porphyra purpurea GN=rps19 PE=3 SV=1 79 126 1.0E-06
sp|C1CP92|RS19_STRZT 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|C1CIA1|RS19_STRZP 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain P1031) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|C1CC10|RS19_STRZJ 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain JJA) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|A4VSF8|RS19_STRSY 30S ribosomal protein S19 OS=Streptococcus suis (strain 05ZYH33) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|A3CK67|RS19_STRSV 30S ribosomal protein S19 OS=Streptococcus sanguinis (strain SK36) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|A4VYP7|RS19_STRS2 30S ribosomal protein S19 OS=Streptococcus suis (strain 98HAH33) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|P0A4B6|RS19_STRR6 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|B2IS44|RS19_STRPS 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|P0A4B5|RS19_STRPN 30S ribosomal protein S19 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|B8ZKG1|RS19_STRPJ 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|B1I8K2|RS19_STRPI 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|C1CAL6|RS19_STRP7 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain 70585) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|B5E6F9|RS19_STRP4 30S ribosomal protein S19 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q04MN2|RS19_STRP2 30S ribosomal protein S19 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|A8AZM1|RS19_STRGC 30S ribosomal protein S19 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q04G81|RS19_OENOB 30S ribosomal protein S19 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsS PE=3 SV=1 52 126 1.0E-06
sp|Q88XY2|RS19_LACPL 30S ribosomal protein S19 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsS PE=3 SV=1 52 126 1.0E-06
sp|Q3IF21|RS19_PSEHT 30S ribosomal protein S19 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsS PE=3 SV=1 59 127 1.0E-06
sp|B9DSV4|RS19_STRU0 30S ribosomal protein S19 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q5M2B7|RS19_STRT2 30S ribosomal protein S19 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q5LXR5|RS19_STRT1 30S ribosomal protein S19 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|C0MCB4|RS19_STRS7 30S ribosomal protein S19 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|P0DE83|RS19_STRPQ 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q48VU5|RS19_STRPM 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|A2RC18|RS19_STRPG 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q1J910|RS19_STRPF 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|Q1JJ58|RS19_STRPD 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|Q1JP13|RS19_STRPC 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|Q1JE54|RS19_STRPB 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|P66498|RS19_STRP8 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q5XED1|RS19_STRP6 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|P0DE82|RS19_STRP3 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|P66496|RS19_STRP1 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M1 GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|B4U504|RS19_STREM 30S ribosomal protein S19 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsS PE=3 SV=2 52 127 1.0E-06
sp|C0M7R3|RS19_STRE4 30S ribosomal protein S19 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|P66500|RS19_STRA5 30S ribosomal protein S19 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|P66499|RS19_STRA3 30S ribosomal protein S19 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|Q3K3W5|RS19_STRA1 30S ribosomal protein S19 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsS PE=3 SV=1 52 127 1.0E-06
sp|A4IZT0|RS19_FRATW 30S ribosomal protein S19 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|Q5NHW4|RS19_FRATT 30S ribosomal protein S19 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|Q0BNS3|RS19_FRATO 30S ribosomal protein S19 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|A0Q4I7|RS19_FRATN 30S ribosomal protein S19 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|B2SDY1|RS19_FRATM 30S ribosomal protein S19 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|Q2A5G6|RS19_FRATH 30S ribosomal protein S19 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|A7N9T0|RS19_FRATF 30S ribosomal protein S19 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|Q14JB6|RS19_FRAT1 30S ribosomal protein S19 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsS PE=3 SV=1 54 129 1.0E-06
sp|Q332T6|RR19_LACSA 30S ribosomal protein S19, chloroplastic OS=Lactuca sativa GN=rps19 PE=3 SV=1 52 127 1.0E-06
sp|B2LMN4|RR19_GUIAB 30S ribosomal protein S19, chloroplastic OS=Guizotia abyssinica GN=rps19 PE=3 SV=1 52 127 1.0E-06
sp|B3E7T9|RS19_GEOLS 30S ribosomal protein S19 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|Q8D208|RS19_WIGBR 30S ribosomal protein S19 OS=Wigglesworthia glossinidia brevipalpis GN=rpsS PE=3 SV=2 54 126 2.0E-06
sp|Q3Z977|RS19_DEHM1 30S ribosomal protein S19 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|Q05FI8|RS19_CARRP 30S ribosomal protein S19 OS=Carsonella ruddii (strain PV) GN=rpsS PE=3 SV=1 77 129 2.0E-06
sp|A3DJH6|RS19_CLOTH 30S ribosomal protein S19 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsS PE=3 SV=1 52 127 2.0E-06
sp|Q3ZZM0|RS19_DEHMC 30S ribosomal protein S19 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|A5FRX9|RS19_DEHMB 30S ribosomal protein S19 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|A6MM77|RR19_BUXMI 30S ribosomal protein S19, chloroplastic OS=Buxus microphylla GN=rps19 PE=3 SV=1 54 127 2.0E-06
sp|A8YXK9|RS19_LACH4 30S ribosomal protein S19 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsS PE=3 SV=1 52 126 2.0E-06
sp|A8ZV61|RS19_DESOH 30S ribosomal protein S19 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|B1MW10|RS19_LEUCK 30S ribosomal protein S19 OS=Leuconostoc citreum (strain KM20) GN=rpsS PE=3 SV=1 52 126 2.0E-06
sp|Q09WX7|RR19_MORIN 30S ribosomal protein S19, chloroplastic OS=Morus indica GN=rps19 PE=3 SV=1 54 127 2.0E-06
sp|A9BCP3|RS19_PROM4 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9211) GN=rpsS PE=3 SV=1 52 127 2.0E-06
sp|Q7MYF5|RS19_PHOLL 30S ribosomal protein S19 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|C5BQ65|RS19_TERTT 30S ribosomal protein S19 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsS PE=3 SV=1 54 129 2.0E-06
sp|B0C1D7|RS19_ACAM1 30S ribosomal protein S19 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsS PE=3 SV=1 52 127 2.0E-06
sp|A5N4Q1|RS19_CLOK5 30S ribosomal protein S19 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|B9DYB3|RS19_CLOK1 30S ribosomal protein S19 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|B1GZ87|RS19_UNCTG 30S ribosomal protein S19 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpsS PE=3 SV=1 82 127 2.0E-06
sp|Q3AUW8|RS19_SYNS9 30S ribosomal protein S19 OS=Synechococcus sp. (strain CC9902) GN=rpsS PE=3 SV=1 52 127 2.0E-06
sp|A1VIQ4|RS19_POLNA 30S ribosomal protein S19 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|A6LPR5|RS19_CLOB8 30S ribosomal protein S19 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|A4QL59|RR19_DRANE 30S ribosomal protein S19, chloroplastic OS=Draba nemorosa GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|A9B416|RS19_HERA2 30S ribosomal protein S19 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpsS PE=3 SV=2 52 127 2.0E-06
sp|A4QJX1|RR19_OLIPU 30S ribosomal protein S19, chloroplastic OS=Olimarabidopsis pumila GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|A4QLX3|RR19_NASOF 30S ribosomal protein S19, chloroplastic OS=Nasturtium officinale GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|A4QLE6|RR19_LEPVR 30S ribosomal protein S19, chloroplastic OS=Lepidium virginicum GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|A4QKX1|RR19_CRUWA 30S ribosomal protein S19, chloroplastic OS=Crucihimalaya wallichii GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|A4QKN2|RR19_CAPBU 30S ribosomal protein S19, chloroplastic OS=Capsella bursa-pastoris GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|A4QKE5|RR19_BARVE 30S ribosomal protein S19, chloroplastic OS=Barbarea verna GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|P56808|RR19_ARATH 30S ribosomal protein S19, chloroplastic OS=Arabidopsis thaliana GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|A4QK58|RR19_ARAHI 30S ribosomal protein S19, chloroplastic OS=Arabis hirsuta GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|Q3ZJ86|RR19_PSEAK 30S ribosomal protein S19, chloroplastic OS=Pseudendoclonium akinetum GN=rps19 PE=3 SV=1 52 127 2.0E-06
sp|Q9L0D6|RS19_STRCO 30S ribosomal protein S19 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|Q3J8R8|RS19_NITOC 30S ribosomal protein S19 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|Q4ZMP8|RS19_PSEU2 30S ribosomal protein S19 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|Q4K537|RS19_PSEF5 30S ribosomal protein S19 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|Q48D40|RS19_PSE14 30S ribosomal protein S19 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|Q3A6P3|RS19_PELCD 30S ribosomal protein S19 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|Q2L945|RR19_GOSHI 30S ribosomal protein S19, chloroplastic OS=Gossypium hirsutum GN=rps19 PE=3 SV=1 54 127 2.0E-06
sp|A0ZZ75|RR19_GOSBA 30S ribosomal protein S19, chloroplastic OS=Gossypium barbadense GN=rps19 PE=3 SV=1 54 127 2.0E-06
sp|Q5QXY1|RS19_IDILO 30S ribosomal protein S19 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsS PE=3 SV=1 54 127 2.0E-06
sp|C1DKL7|RS19_AZOVD 30S ribosomal protein S19 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsS PE=3 SV=1 54 129 2.0E-06
sp|Q12GW7|RS19_POLSJ 30S ribosomal protein S19 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsS PE=3 SV=1 52 129 2.0E-06
sp|Q1AU33|RS19_RUBXD 30S ribosomal protein S19 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|A0LIJ4|RS19_SYNFM 30S ribosomal protein S19 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|O24693|RS19_SYNP6 30S ribosomal protein S19 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q31L11|RS19_SYNE7 30S ribosomal protein S19 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q889W7|RS19_PSESM 30S ribosomal protein S19 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q47LJ7|RS19_THEFY 30S ribosomal protein S19 OS=Thermobifida fusca (strain YX) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|B4UBA3|RS19_ANASK 30S ribosomal protein S19 OS=Anaeromyxobacter sp. (strain K) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q2IJ80|RS19_ANADE 30S ribosomal protein S19 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|B8J864|RS19_ANAD2 30S ribosomal protein S19 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q1LTD4|RS19_BAUCH 30S ribosomal protein S19 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|A6H5M2|RR19_CYCTA 30S ribosomal protein S19, chloroplastic OS=Cycas taitungensis GN=rps19 PE=3 SV=1 54 127 3.0E-06
sp|A7HBM2|RS19_ANADF 30S ribosomal protein S19 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|B2TIH9|RS19_CLOBB 30S ribosomal protein S19 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpsS PE=3 SV=1 52 129 3.0E-06
sp|B2UYB4|RS19_CLOBA 30S ribosomal protein S19 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpsS PE=3 SV=1 52 129 3.0E-06
sp|B3V4Q2|RR19_OEDCA 30S ribosomal protein S19, chloroplastic OS=Oedogonium cardiacum GN=rps19 PE=3 SV=1 54 129 3.0E-06
sp|A8W3M2|RR19_CUSOB 30S ribosomal protein S19, plastid OS=Cuscuta obtusiflora GN=rps19 PE=3 SV=1 63 129 3.0E-06
sp|P66480|RS19_CHLTR 30S ribosomal protein S19 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|B0BCG3|RS19_CHLTB 30S ribosomal protein S19 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|Q3KLH3|RS19_CHLTA 30S ribosomal protein S19 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|B0B898|RS19_CHLT2 30S ribosomal protein S19 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|P66481|RS19_CHLMU 30S ribosomal protein S19 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|Q3AMN4|RS19_SYNSC 30S ribosomal protein S19 OS=Synechococcus sp. (strain CC9605) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|Q1KXR8|RR19_HELAN 30S ribosomal protein S19, chloroplastic OS=Helianthus annuus GN=rps19 PE=3 SV=1 52 127 3.0E-06
sp|A7M936|RR19_CUSGR 30S ribosomal protein S19, plastid OS=Cuscuta gronovii GN=rps19 PE=3 SV=1 56 129 3.0E-06
sp|Q605B6|RS19_METCA 30S ribosomal protein S19 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q20F11|RR19_OLTVI 30S ribosomal protein S19, chloroplastic OS=Oltmannsiellopsis viridis GN=rps19 PE=3 SV=1 52 127 3.0E-06
sp|B3PK41|RS19_CELJU 30S ribosomal protein S19 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsS PE=3 SV=1 54 129 3.0E-06
sp|Q46IR3|RS19_PROMT 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|A2C4Z5|RS19_PROM1 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|Q07KM2|RS19_RHOP5 30S ribosomal protein S19 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsS PE=3 SV=1 67 127 3.0E-06
sp|Q1WS94|RS19_LACS1 30S ribosomal protein S19 OS=Lactobacillus salivarius (strain UCC118) GN=rpsS PE=3 SV=1 52 126 3.0E-06
sp|B8G6S1|RS19_CHLAD 30S ribosomal protein S19 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|Q3BAH0|RR19_PHAAO 30S ribosomal protein S19, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=rps19 PE=3 SV=1 52 127 3.0E-06
sp|Q3V4Z3|RR19_ACOCL 30S ribosomal protein S19, chloroplastic OS=Acorus calamus GN=rps19 PE=3 SV=1 52 127 3.0E-06
sp|B1JIW5|RS19_YERPY 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|P11256|RS19_YERPS 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsS PE=3 SV=4 54 127 3.0E-06
sp|A4TGZ6|RS19_YERPP 30S ribosomal protein S19 OS=Yersinia pestis (strain Pestoides F) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q1CCU8|RS19_YERPN 30S ribosomal protein S19 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|A9R900|RS19_YERPG 30S ribosomal protein S19 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q8ZJA8|RS19_YERPE 30S ribosomal protein S19 OS=Yersinia pestis GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|B2K5M6|RS19_YERPB 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q1C2V1|RS19_YERPA 30S ribosomal protein S19 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|A7FNN1|RS19_YERP3 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|A1JS33|RS19_YERE8 30S ribosomal protein S19 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsS PE=3 SV=1 54 127 3.0E-06
sp|Q0ID09|RS19_SYNS3 30S ribosomal protein S19 OS=Synechococcus sp. (strain CC9311) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|A4VHN4|RS19_PSEU5 30S ribosomal protein S19 OS=Pseudomonas stutzeri (strain A1501) GN=rpsS PE=3 SV=1 54 129 3.0E-06
sp|Q7V9W6|RS19_PROMA 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsS PE=3 SV=1 52 127 3.0E-06
sp|Q7W2F2|RS19_BORPA 30S ribosomal protein S19 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsS PE=3 SV=1 52 129 3.0E-06
sp|Q7WRC1|RS19_BORBR 30S ribosomal protein S19 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsS PE=3 SV=1 52 129 3.0E-06
sp|B6YQ81|RS19_AZOPC 30S ribosomal protein S19 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsS PE=3 SV=1 77 127 3.0E-06
sp|B1YGV4|RS19_EXIS2 30S ribosomal protein S19 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|B9L6M9|RS19_NAUPA 30S ribosomal protein S19 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsS PE=3 SV=1 54 127 4.0E-06
sp|B2S2E0|RS19_TREPS 30S ribosomal protein S19 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|O83223|RS19_TREPA 30S ribosomal protein S19 OS=Treponema pallidum (strain Nichols) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|Q7VQE4|RS19_BLOFL 30S ribosomal protein S19 OS=Blochmannia floridanus GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|Q70XX0|RR19_AMBTC 30S ribosomal protein S19, chloroplastic OS=Amborella trichopoda GN=rps19 PE=3 SV=1 52 127 4.0E-06
sp|Q3K5Z2|RS19_PSEPF 30S ribosomal protein S19 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsS PE=3 SV=1 54 127 4.0E-06
sp|B9KZY3|RS19_THERP 30S ribosomal protein S19 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpsS PE=3 SV=1 66 127 4.0E-06
sp|B1X504|RR19_PAUCH 30S ribosomal protein S19, organellar chromatophore OS=Paulinella chromatophora GN=rps19 PE=3 SV=1 52 127 4.0E-06
sp|Q1KVT8|RR19_ACUOB 30S ribosomal protein S19, chloroplastic OS=Acutodesmus obliquus GN=rps19 PE=3 SV=1 52 127 4.0E-06
sp|C6C189|RS19_DESAD 30S ribosomal protein S19 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsS PE=3 SV=1 54 127 4.0E-06
sp|Q839G0|RS19_ENTFA 30S ribosomal protein S19 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|Q7TUP5|RS19_PROMM 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|A2CC31|RS19_PROM3 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|B7KHZ1|RS19_CYAP7 30S ribosomal protein S19 OS=Cyanothece sp. (strain PCC 7424) GN=rpsS PE=3 SV=1 54 127 4.0E-06
sp|Q82DP1|RS19_STRAW 30S ribosomal protein S19 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsS PE=3 SV=1 54 127 4.0E-06
sp|B8IYH6|RS19_DESDA 30S ribosomal protein S19 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsS PE=3 SV=1 54 127 4.0E-06
sp|B4SKW7|RS19_STRM5 30S ribosomal protein S19 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsS PE=3 SV=1 54 129 4.0E-06
sp|A5USI5|RS19_ROSS1 30S ribosomal protein S19 OS=Roseiflexus sp. (strain RS-1) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|Q11HQ6|RS19_CHESB 30S ribosomal protein S19 OS=Chelativorans sp. (strain BNC1) GN=rpsS PE=3 SV=1 63 127 4.0E-06
sp|Q3SSW2|RS19_NITWN 30S ribosomal protein S19 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsS PE=3 SV=1 67 127 4.0E-06
sp|Q9Z9L0|RS19_BACHD 30S ribosomal protein S19 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsS PE=3 SV=1 52 127 4.0E-06
sp|Q09MB1|RR19_CITSI 30S ribosomal protein S19, chloroplastic OS=Citrus sinensis GN=rps19 PE=3 SV=1 52 127 4.0E-06
sp|P49506|RR19_ODOSI 30S ribosomal protein S19, chloroplastic OS=Odontella sinensis GN=rps19 PE=3 SV=1 54 126 4.0E-06
sp|Q04C11|RS19_LACDB 30S ribosomal protein S19 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsS PE=3 SV=1 52 126 5.0E-06
sp|Q1GBL4|RS19_LACDA 30S ribosomal protein S19 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsS PE=3 SV=1 52 126 5.0E-06
sp|A9IIZ4|RS19_BORPD 30S ribosomal protein S19 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsS PE=3 SV=1 52 129 5.0E-06
sp|C6E4Q3|RS19_GEOSM 30S ribosomal protein S19 OS=Geobacter sp. (strain M21) GN=rpsS PE=3 SV=1 54 127 5.0E-06
sp|B5EFQ4|RS19_GEOBB 30S ribosomal protein S19 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsS PE=3 SV=1 54 127 5.0E-06
sp|A6Q1I2|RS19_NITSB 30S ribosomal protein S19 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsS PE=3 SV=1 54 127 5.0E-06
sp|Q1XDH8|RR19_PYRYE 30S ribosomal protein S19, chloroplastic OS=Pyropia yezoensis GN=rps19 PE=3 SV=1 79 126 5.0E-06
sp|P38520|RS19_THEMA 30S ribosomal protein S19 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsS PE=3 SV=2 63 127 5.0E-06
sp|Q36570|RR19_NICBI 30S ribosomal protein S19, chloroplastic OS=Nicotiana bigelovii GN=rps19 PE=3 SV=5 52 127 5.0E-06
sp|Q1ACF7|RR19_CHAVU 30S ribosomal protein S19, chloroplastic OS=Chara vulgaris GN=rps19 PE=3 SV=1 52 129 5.0E-06
sp|B3E0I8|RS19_METI4 30S ribosomal protein S19 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsS PE=3 SV=1 52 127 5.0E-06
sp|A4XZ86|RS19_PSEMY 30S ribosomal protein S19 OS=Pseudomonas mendocina (strain ymp) GN=rpsS PE=3 SV=1 54 127 5.0E-06
sp|A1T0D8|RS19_PSYIN 30S ribosomal protein S19 OS=Psychromonas ingrahamii (strain 37) GN=rpsS PE=3 SV=1 54 127 5.0E-06
sp|P53733|RT19_YEAST 37S ribosomal protein S19, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM19 PE=1 SV=1 48 127 5.0E-06
sp|Q7VTC9|RS19_BORPE 30S ribosomal protein S19 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsS PE=3 SV=1 52 129 5.0E-06
sp|Q2IXQ6|RS19_RHOP2 30S ribosomal protein S19 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsS PE=3 SV=1 67 127 6.0E-06
sp|B9K890|RS19_THENN 30S ribosomal protein S19 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsS PE=3 SV=1 63 127 6.0E-06
sp|Q74L85|RS19_LACJO 30S ribosomal protein S19 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsS PE=3 SV=1 52 126 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3799
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|854
Ophiocordyceps australis map64 (Brazil) OphauB2|2960
Ophiocordyceps camponoti-floridani Ophcf2|00208
Ophiocordyceps camponoti-rufipedis Ophun1|6249 (this protein)
Ophiocordyceps kimflemingae Ophio5|4321
Ophiocordyceps subramaniannii Hirsu2|7416

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6249
MADEYNAEEAAELKKRRAFRKFSYRGIDLDHLLDLSSDQLRDVVHARARRRINRGLKRRPMGLIKKLRKAKQEAK
PNEKPDLVKTHLRDMLVVPEMIGSMIGIYSGKEFNQVEIKPEMVGHYLAEFSIS*
Coding >Ophun1|6249
ATGGCTGACGAATACAACGCCGAGGAGGCCGCCGAGCTCAAGAAGAGAAGAGCCTTTCGCAAGTTTTCCTACCGA
GGAATTGATCTCGACCACCTCCTGGACCTCAGCTCCGACCAGCTGCGCGATGTCGTGCACGCGCGTGCCCGCCGC
AGGATCAACCGCGGCCTGAAGCGCCGGCCCATGGGTCTCATCAAGAAGCTTCGCAAGGCCAAGCAAGAGGCCAAG
CCCAACGAGAAGCCCGACCTCGTCAAGACTCACCTTCGCGACATGCTTGTCGTTCCCGAGATGATTGGCAGCATG
ATTGGCATCTACTCCGGCAAGGAGTTCAACCAGGTGGAGATTAAGCCCGAGATGGTCGGTCACTACCTGGCCGAG
TTCTCCATCTCCTAG
Transcript >Ophun1|6249
ATGGCTGACGAATACAACGCCGAGGAGGCCGCCGAGCTCAAGAAGAGAAGAGCCTTTCGCAAGTTTTCCTACCGA
GGAATTGATCTCGACCACCTCCTGGACCTCAGCTCCGACCAGCTGCGCGATGTCGTGCACGCGCGTGCCCGCCGC
AGGATCAACCGCGGCCTGAAGCGCCGGCCCATGGGTCTCATCAAGAAGCTTCGCAAGGCCAAGCAAGAGGCCAAG
CCCAACGAGAAGCCCGACCTCGTCAAGACTCACCTTCGCGACATGCTTGTCGTTCCCGAGATGATTGGCAGCATG
ATTGGCATCTACTCCGGCAAGGAGTTCAACCAGGTGGAGATTAAGCCCGAGATGGTCGGTCACTACCTGGCCGAG
TTCTCCATCTCCTAG
Gene >Ophun1|6249
ATGGCTGACGAATACGTGCGTTCTGCGCCTCTTCCCGACTTCTTCGGACACCTGTGGCCGTCTTGCTGACGATGA
TGCGGTGCAGAACGCCGAGGAGGCCGCCGAGCTCAAGAAGAGAAGAGCCTTTCGCAAGTTTTCCTACCGAGGAAT
TGATCTCGACCAGTGCGTTTACTCCTGCAACCTCGTTTTTTCTTCTCTGCGTGACGAAACGCGGTGTCAAAGGAA
AGGCCATGGCTGACTTTGGCCCTTTTTCTCTCGGTTAGCCTCCTGGACCTCAGCTCCGACCAGCTGCGCGATGTC
GTGCACGCGCGTGCCCGCCGCAGGATCAACCGCGGCCTGAAGCGCCGGCCCATGGGTCTCATCAAGAAGCTTCGC
AAGGCCAAGCAAGAGGCCAAGCCCAACGAGAAGCCCGACCTCGTCAAGACTCACCTTCGCGACATGCTTGTCGTT
CCCGAGATGATTGGCAGCATGATTGGCATCTACTCCGGCAAGGAGTTCAACCAGGTGGAGATTAAGCCCGAGATG
GTCGGTCACTACCTGGCCGAGTTCTCCATCTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail