Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6244
Gene name
LocationContig_67:21770..22120
Strand+
Gene length (bp)350
Transcript length (bp)225
Coding sequence length (bp)225
Protein length (aa) 75

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09813 Coa3_cc Cytochrome c oxidase assembly factor 3 1.7E-15 20 60

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B9WK46|COA3_CANDC Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=COA3 PE=3 SV=1 3 64 3.0E-10
sp|C4YTL7|COA3_CANAW Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida albicans (strain WO-1) GN=COA3 PE=3 SV=1 3 64 3.0E-10
sp|A5DLM7|COA3_PICGU Cytochrome c oxidase assembly factor 3, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=COA3 PE=3 SV=2 6 73 1.0E-09
sp|C4YBX9|COA3_CLAL4 Cytochrome c oxidase assembly factor 3, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=COA3 PE=3 SV=1 3 64 2.0E-09
sp|Q6BL60|COA3_DEBHA Cytochrome c oxidase assembly factor 3, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COA3 PE=3 SV=1 3 64 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B9WK46|COA3_CANDC Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=COA3 PE=3 SV=1 3 64 3.0E-10
sp|C4YTL7|COA3_CANAW Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida albicans (strain WO-1) GN=COA3 PE=3 SV=1 3 64 3.0E-10
sp|A5DLM7|COA3_PICGU Cytochrome c oxidase assembly factor 3, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=COA3 PE=3 SV=2 6 73 1.0E-09
sp|C4YBX9|COA3_CLAL4 Cytochrome c oxidase assembly factor 3, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=COA3 PE=3 SV=1 3 64 2.0E-09
sp|Q6BL60|COA3_DEBHA Cytochrome c oxidase assembly factor 3, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COA3 PE=3 SV=1 3 64 3.0E-09
sp|A3LWK1|COA3_PICST Cytochrome c oxidase assembly factor 3, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=COA3 PE=3 SV=1 3 64 7.0E-09
sp|Q6CHT7|COA3_YARLI Cytochrome c oxidase assembly factor 3, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COA3 PE=3 SV=1 15 64 3.0E-08
sp|A5E7J0|COA3_LODEL Cytochrome c oxidase assembly factor 3, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=COA3 PE=3 SV=1 16 64 1.0E-07
sp|C5E368|COA3_LACTC Cytochrome c oxidase assembly factor 3, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=COA3 PE=3 SV=1 7 64 3.0E-07
sp|Q758B5|COA3_ASHGO Cytochrome c oxidase assembly factor 3, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COA3 PE=3 SV=1 7 64 5.0E-07
sp|A7TQM5|COA3_VANPO Cytochrome c oxidase assembly factor 3, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=COA3 PE=3 SV=1 7 64 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6244
MFPHAHSTYYDRRNRIGPALARARRPYLFRNTVTGLGLMSIVIGIYVYTIKAVGQDEFADVKVPDAPRQPAGKN*
Coding >Ophun1|6244
ATGTTCCCTCACGCACATTCAACCTACTACGACCGACGCAACAGGATCGGCCCAGCCCTCGCCCGAGCCCGACGA
CCGTATCTGTTCCGCAACACCGTCACTGGCTTGGGCTTGATGTCCATCGTCATAGGCATCTATGTATACACCATC
AAGGCCGTCGGCCAGGACGAATTCGCCGATGTCAAGGTGCCAGATGCCCCTCGACAACCAGCCGGCAAGAACTAG
Transcript >Ophun1|6244
ATGTTCCCTCACGCACATTCAACCTACTACGACCGACGCAACAGGATCGGCCCAGCCCTCGCCCGAGCCCGACGA
CCGTATCTGTTCCGCAACACCGTCACTGGCTTGGGCTTGATGTCCATCGTCATAGGCATCTATGTATACACCATC
AAGGCCGTCGGCCAGGACGAATTCGCCGATGTCAAGGTGCCAGATGCCCCTCGACAACCAGCCGGCAAGAACTAG
Gene >Ophun1|6244
ATGTTCCCTCAGTAAGAGATGCTCCCTCCTCTATCTCCTAGACCACAACTCACCGCTCGCCTCCCACAGCGCACA
TTCAACCTACTACGACCGACGCAACAGGATCGGCCCAGCCCTCGCCCGAGCCCGACGACCGTATCTGTTCCGCAA
CACCGTCACTGGCTTGGGCTTGATGTCCATCGTCATAGGCATCTGTGAGAACCGCTGCGCTCTGGCAAACTGCCG
ACCGATGAGCATGGGAATACTCACGAGCTGCCACAGATGTATACACCATCAAGGCCGTCGGCCAGGACGAATTCG
CCGATGTCAAGGTGCCAGATGCCCCTCGACAACCAGCCGGCAAGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail