Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6238
Gene name
LocationContig_67:4830..6814
Strand-
Gene length (bp)1984
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.9E-26 77 484
PF00083 Sugar_tr Sugar (and other) transporter 3.5E-05 109 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 12 562 4.0E-39
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 46 561 2.0E-32
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 27 558 1.0E-17
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 23 283 4.0E-16
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 28 250 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 12 562 4.0E-39
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 46 561 2.0E-32
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 27 558 1.0E-17
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 23 283 4.0E-16
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 28 250 4.0E-14
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 22 390 7.0E-14
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 22 283 8.0E-13
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 55 302 3.0E-12
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 32 413 5.0E-12
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 13 466 1.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 59 334 2.0E-10
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 56 272 2.0E-10
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 28 271 3.0E-09
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 56 556 4.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 56 250 6.0E-08
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 56 466 1.0E-07
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 55 287 2.0E-07
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 55 287 3.0E-07
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 36 557 5.0E-07
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 22 250 7.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 23 250 2.0E-06
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 59 330 4.0E-06
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 50 228 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 105 127 22
3 137 156 19
4 198 215 17
5 225 247 22
6 357 379 22
7 389 411 22
8 432 451 19
9 466 488 22
10 495 517 22
11 530 552 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6238
MGLWILEPPPGQEAPGTSRYYGELDAPQARSSSDDTQLKCDTDHGDAVILSPQPSDDPNDPLNWPLWKRDLITFI
LCFAGILATSLSSILAANTVVLTLHFRITLAKAAVLTGYFTLGTGAAAIFFVPSGRVWGKRHLFLLGTCIVIASG
AWAGAVGRNYKSMAAARAIQGMAAAPFETLLNAAVGDLYFVHQRGVRMAATNLAVFGAAFFTPVVTGKITEAMGW
QWTFNLVAIFTAVTLPAVFFFCPETAFRREPRRTNAVVEQHNGEGEKMGWTPEQKSQRAGHDDDDVIVHPPGFVL
VPTSSAMQPTGDSRTPRKSFVQSLSLFDGRKTDERYWVLLLRPFPLLMNPAFIWACLIQGAMIGWTVFIGVLVAI
LFIGPPYFWGEVAAGYTYIGPFVGSLAGFAISGLLADSSVKALTKLNRGIYEPEFRILLVVPMLIVGSIGLYGFG
LTADAVSSGKFHFVVPPMFFGFVTAAMVIGAVASSLYIVDGYRDITVEAFTLTIIFKNIFSFVLTWYAYDWVIQT
GMRRLILTIATIQVGICLLSIPMYIWGKRARAFFHRHDPLAMTRLR*
Coding >Ophun1|6238
ATGGGACTCTGGATTCTCGAGCCGCCGCCCGGCCAAGAGGCACCTGGCACCTCGCGATACTACGGTGAGCTCGAC
GCGCCTCAGGCTAGGAGCAGCAGCGACGACACGCAGCTCAAGTGCGATACCGACCATGGTGATGCCGTCATCCTC
AGTCCGCAGCCGTCTGATGATCCCAACGATCCGCTCAATTGGCCGCTATGGAAGCGCGATCTCATCACCTTCATC
CTCTGCTTCGCCGGCATCTTGGCCACGTCCCTGAGCTCCATCCTGGCCGCCAACACGGTAGTGCTTACGCTGCAC
TTTCGCATCACGCTCGCCAAAGCGGCCGTACTTACAGGCTATTTCACCCTGGGCACCGGCGCGGCCGCCATCTTC
TTCGTACCCTCGGGCCGCGTCTGGGGCAAGCGTCATCTCTTCCTCCTCGGAACCTGCATCGTCATCGCCTCGGGC
GCATGGGCCGGAGCCGTGGGGCGCAACTACAAGAGCATGGCGGCTGCCAGGGCTATCCAGGGCATGGCCGCGGCG
CCCTTTGAGACGCTGCTCAACGCCGCTGTCGGCGACCTCTACTTTGTCCACCAGAGAGGCGTGCGCATGGCGGCC
ACCAACCTGGCCGTCTTTGGCGCTGCCTTCTTCACACCCGTCGTCACGGGTAAGATTACCGAGGCCATGGGCTGG
CAGTGGACTTTCAATCTGGTGGCCATCTTCACGGCCGTCACCTTACCCGCCGTCTTCTTCTTCTGTCCCGAGACG
GCCTTTCGTCGAGAGCCACGACGGACGAATGCCGTTGTCGAGCAGCACAATGGCGAGGGAGAAAAGATGGGCTGG
ACGCCCGAGCAAAAGTCACAGCGTGCCGGACACGACGACGACGACGTCATTGTCCATCCTCCGGGCTTCGTCTTG
GTGCCCACGTCGTCGGCCATGCAGCCCACAGGCGACAGCAGGACGCCCAGGAAGTCGTTCGTCCAGTCGCTGTCG
CTCTTCGACGGGCGTAAGACGGACGAGCGCTACTGGGTTCTGCTGCTACGGCCCTTTCCGCTGCTCATGAACCCG
GCCTTTATATGGGCATGTCTGATACAGGGCGCCATGATCGGCTGGACCGTCTTCATCGGCGTCCTCGTCGCCATC
CTCTTCATCGGTCCTCCTTACTTCTGGGGCGAGGTGGCTGCCGGCTACACGTACATCGGGCCCTTTGTCGGCTCG
CTCGCCGGCTTCGCCATCTCGGGCCTGCTGGCCGACAGCAGCGTCAAGGCGCTGACGAAGCTCAACAGGGGCATC
TACGAGCCCGAGTTCCGCATCCTGCTCGTCGTTCCCATGCTCATCGTGGGTAGCATTGGCCTGTACGGCTTTGGG
CTGACGGCCGACGCCGTCTCGTCGGGCAAGTTTCACTTTGTCGTACCGCCCATGTTCTTTGGCTTCGTGACGGCG
GCCATGGTCATTGGCGCCGTGGCCAGCTCGCTGTACATTGTCGACGGCTATCGTGACATCACTGTCGAGGCCTTT
ACCCTTACCATCATCTTTAAGAACATCTTTAGCTTCGTCCTGACCTGGTATGCTTACGACTGGGTCATTCAGACC
GGCATGCGGCGTCTCATCCTCACCATCGCCACCATCCAGGTCGGCATCTGCCTCCTGAGCATTCCAATGTACATC
TGGGGAAAGCGAGCCAGGGCCTTTTTCCACCGGCACGATCCCCTAGCCATGACGCGTCTACGATGA
Transcript >Ophun1|6238
ATGGGACTCTGGATTCTCGAGCCGCCGCCCGGCCAAGAGGCACCTGGCACCTCGCGATACTACGGTGAGCTCGAC
GCGCCTCAGGCTAGGAGCAGCAGCGACGACACGCAGCTCAAGTGCGATACCGACCATGGTGATGCCGTCATCCTC
AGTCCGCAGCCGTCTGATGATCCCAACGATCCGCTCAATTGGCCGCTATGGAAGCGCGATCTCATCACCTTCATC
CTCTGCTTCGCCGGCATCTTGGCCACGTCCCTGAGCTCCATCCTGGCCGCCAACACGGTAGTGCTTACGCTGCAC
TTTCGCATCACGCTCGCCAAAGCGGCCGTACTTACAGGCTATTTCACCCTGGGCACCGGCGCGGCCGCCATCTTC
TTCGTACCCTCGGGCCGCGTCTGGGGCAAGCGTCATCTCTTCCTCCTCGGAACCTGCATCGTCATCGCCTCGGGC
GCATGGGCCGGAGCCGTGGGGCGCAACTACAAGAGCATGGCGGCTGCCAGGGCTATCCAGGGCATGGCCGCGGCG
CCCTTTGAGACGCTGCTCAACGCCGCTGTCGGCGACCTCTACTTTGTCCACCAGAGAGGCGTGCGCATGGCGGCC
ACCAACCTGGCCGTCTTTGGCGCTGCCTTCTTCACACCCGTCGTCACGGGTAAGATTACCGAGGCCATGGGCTGG
CAGTGGACTTTCAATCTGGTGGCCATCTTCACGGCCGTCACCTTACCCGCCGTCTTCTTCTTCTGTCCCGAGACG
GCCTTTCGTCGAGAGCCACGACGGACGAATGCCGTTGTCGAGCAGCACAATGGCGAGGGAGAAAAGATGGGCTGG
ACGCCCGAGCAAAAGTCACAGCGTGCCGGACACGACGACGACGACGTCATTGTCCATCCTCCGGGCTTCGTCTTG
GTGCCCACGTCGTCGGCCATGCAGCCCACAGGCGACAGCAGGACGCCCAGGAAGTCGTTCGTCCAGTCGCTGTCG
CTCTTCGACGGGCGTAAGACGGACGAGCGCTACTGGGTTCTGCTGCTACGGCCCTTTCCGCTGCTCATGAACCCG
GCCTTTATATGGGCATGTCTGATACAGGGCGCCATGATCGGCTGGACCGTCTTCATCGGCGTCCTCGTCGCCATC
CTCTTCATCGGTCCTCCTTACTTCTGGGGCGAGGTGGCTGCCGGCTACACGTACATCGGGCCCTTTGTCGGCTCG
CTCGCCGGCTTCGCCATCTCGGGCCTGCTGGCCGACAGCAGCGTCAAGGCGCTGACGAAGCTCAACAGGGGCATC
TACGAGCCCGAGTTCCGCATCCTGCTCGTCGTTCCCATGCTCATCGTGGGTAGCATTGGCCTGTACGGCTTTGGG
CTGACGGCCGACGCCGTCTCGTCGGGCAAGTTTCACTTTGTCGTACCGCCCATGTTCTTTGGCTTCGTGACGGCG
GCCATGGTCATTGGCGCCGTGGCCAGCTCGCTGTACATTGTCGACGGCTATCGTGACATCACTGTCGAGGCCTTT
ACCCTTACCATCATCTTTAAGAACATCTTTAGCTTCGTCCTGACCTGGTATGCTTACGACTGGGTCATTCAGACC
GGCATGCGGCGTCTCATCCTCACCATCGCCACCATCCAGGTCGGCATCTGCCTCCTGAGCATTCCAATGTACATC
TGGGGAAAGCGAGCCAGGGCCTTTTTCCACCGGCACGATCCCCTAGCCATGACGCGTCTACGATGA
Gene >Ophun1|6238
ATGGGACTCTGGATTCTCGAGCCGCCGCCCGGCCAAGAGGCACCTGGTAAGGAGGCTCTTCTAGAGCAAGGCCAT
GGATGGCATCGCTGACGACGGCTTCTCTTCTCTCACAGGCACCTCGCGATACTACGGTGAGCTCGACGCGCCTCA
GGCTAGGAGCAGCAGCGACGACACGCAGCTCAAGTGCGATACCGACCATGGTGATGCCGTCATCCTCGTGCGTGC
CTCGACTCCTTTCCCCCCTTACCGCTGAATGACTGCCAACTAGTTACTCATATATCCGCTCGCAGAGTCCGCAGC
CGTCTGATGATCCCAACGATCCGCTCAATTGGCCGCTATGGAAGCGCGATCTCATCACCTTCATCCTCTGCTTCG
CCGGCATCTTGGCCACGTCCCTGAGCTCCATCCTGGCCGCCAACACGGTAGTGCTTACGCTGCACTTTCGCATCA
CGCTCGCCAAAGCGGCCGTACTTACAGGCTATTTCACCCTGGGCACCGGCGCGGCCGCCATCTTCTTCGTACCCT
CGGGCCGCGTCTGGGGCAAGCGTCATCTCTTCCTCCTCGGAACCTGCATCGTCATCGCCTCGGGCGCATGGGCCG
GAGCCGTGGGGCGCAACTACAAGAGCATGGCGGCTGCCAGGGCTATCCAGGGCATGGCCGCGGCGCCCTTTGAGA
CGCTGCTCAACGCCGCTGTCGGCGACCTCTACTTTGTCCACCAGAGAGGCGTGCGCATGGCGGCCACCAACCTGG
CCGTCTTTGGCGCTGCCTTCTTCACACCCGTCGTCACGGGTAAGATTACCGAGGCCATGGGCTGGCAGTGGACTT
TCAATCTGGTGGCCATCTTCACGGCCGTCACCTTACCCGCCGTCTTCTTCTTCTGTCCCGAGACGGCCTTTCGTC
GAGAGCCACGACGGACGAATGCCGTTGTCGAGCAGCACAATGGCGAGGGAGAAAAGATGGGCTGGACGCCCGAGC
AAAAGTCACAGCGTGCCGGACACGACGACGACGACGTCATTGTCCATCCTCCGGGCTTCGTCTTGGTGCCCACGT
CGTCGGCCATGCAGCCCACAGGCGACAGCAGGACGCCCAGGAAGTCGTTCGTCCAGTCGCTGTCGCTCTTCGACG
GGCGTAAGACGGACGAGCGCTACTGGGTTCTGCTGCTACGGCCCTTTCCGCTGCTCATGAACCCGGCCTTTATAT
GGGCATGTCTGATACAGGGCGCCATGATCGGCTGGACCGTCTTCATCGGCGTCCTCGTCGCCATCCTCTTCATCG
GTCCTCCTTACTTCTGGGGCGAGGTGGCTGCCGGCTACACGTACATCGGGCCCTTTGTCGGCTCGCTCGCCGGCT
TCGCCATCTCGGGCCTGCTGGCCGACAGCAGCGTCAAGGCGCTGACGAAGCTCAACAGGGGCATCTACGAGCCCG
AGTTCCGCATCCTGCTCGTCGTTCCCATGCTCATCGTGGGTAGCATTGGCCTGTACGGCTTTGGGCTGACGGCCG
ACGCCGTCTCGTCGGGCAAGTTTCACTTTGTCGTACCGCCCATGTTCTTTGGCTTCGTGACGGCGGCCATGGTCA
TTGGCGCCGTGGCCAGCTCGCTGTACATTGTCGACGGCTATCGTGAGCCTCCCCCTGCCGGTCTCCTGTTGTCTC
TCTCGGGGCACTGACTGAGTGGACACAGGTGACATCACTGTCGAGGCCTTTACCCTTACCATCATCTTTAAGAAC
ATCTTTAGCTTCGTCCTGACCTGGTATGCTTACGACTGGGTCATTCAGACCGGCATGCGGCGTCTCATCCTCACC
ATCGCCACCATCCAGGTCGGCATCTGCCTCCTGAGCATTCCAATGTGTAAGCCAGTCATGGGCCGGTTGTGCCGA
GACAGGGAGGGTATGAAGGCTGACTGCTGGAGGTGCAGACATCTGGGGAAAGCGAGCCAGGGCCTTTTTCCACCG
GCACGATCCCCTAGCCATGACGCGTCTACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail