Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6237
Gene name
LocationContig_67:3082..4610
Strand+
Gene length (bp)1528
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 1.2E-05 46 329

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 433 455 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6237
MELLLASLVLLLQLLRHVSAADDRLLGVYIFHRHGDRTAKAWKPVNLTALGAVQVHSSGSFYRDRYVTGPDALPG
ISPDLAVASQLSVTSPRDPVLQASAQTFVQGLYPPDDTLAETLANGSSVVAPLGGTQYVPVDKAETKAGDRPEDN
AWLQGGSGCVNAEVSSNAYLASAEYRRDYSETLEFYRGLLPVINGTYGEDEANFKNGYSIFDLINVATIHNSSIP
SSSLLTSQSLHRLYTLASTHEWNLAFNTSSPIRSIAGAVLAGQILSSLGSIVNAEPSTPRLHAQFGAYATFMAFF
GLAQLDKASPDFYGICQYASSIVFELVAPNHLNKPGPDDVSVRFLFANGSAAENPLRPFPLFGSTSLLTPWREFA
SAMGQFAIADSAHWCDVCGKKDGECADLVNHSSSKDADDAHGDDGGHHHGGVSRPVAGVIGALVTLVVLLAVIAA
VVLIGGLRFVRNKPRGPPPEETADAAMAKV*
Coding >Ophun1|6237
ATGGAGCTGCTCCTCGCCTCCCTCGTCCTGCTCCTGCAGCTGCTACGTCACGTCTCCGCCGCCGACGACCGCCTG
CTAGGCGTCTACATCTTCCACCGCCACGGCGACCGAACCGCCAAAGCCTGGAAGCCCGTCAATCTCACCGCGCTG
GGAGCCGTCCAGGTCCACTCGTCCGGCTCCTTCTACCGCGACCGCTACGTCACGGGCCCGGACGCCCTCCCCGGC
ATCAGCCCGGACCTGGCCGTCGCCTCTCAGCTGTCCGTGACGTCGCCGCGCGATCCCGTGCTGCAGGCCTCGGCG
CAGACCTTCGTCCAGGGCCTCTACCCCCCTGACGATACGCTGGCCGAGACGCTGGCCAATGGATCGAGCGTCGTG
GCTCCGCTGGGGGGGACGCAGTACGTGCCTGTTGACAAGGCCGAGACAAAGGCTGGCGATCGGCCGGAGGATAAT
GCTTGGTTGCAGGGGGGGAGTGGCTGTGTGAATGCCGAGGTCAGTTCGAATGCCTACCTTGCTTCGGCCGAGTAT
CGCCGAGATTATAGCGAGACGCTGGAGTTTTATCGGGGGTTGCTGCCTGTCATCAACGGCACGTATGGGGAGGAC
GAGGCCAACTTTAAGAATGGATATTCGATCTTCGACCTCATCAACGTCGCAACAATCCACAACTCCTCCATCCCC
TCCTCCTCCCTCCTCACATCCCAATCCCTCCACCGCCTCTACACCCTCGCCTCAACCCACGAATGGAACCTAGCC
TTCAACACCAGCTCCCCCATCCGCTCCATCGCCGGCGCCGTCCTCGCCGGCCAGATCCTCTCCTCCCTCGGCTCC
ATCGTCAACGCAGAGCCCTCGACCCCCCGTCTCCACGCCCAGTTCGGCGCCTACGCCACCTTCATGGCCTTCTTC
GGCCTCGCTCAACTCGATAAAGCCAGCCCGGACTTTTACGGCATCTGTCAGTACGCTTCTTCCATCGTCTTCGAA
CTCGTCGCCCCCAACCATCTCAACAAGCCCGGCCCGGATGACGTCTCCGTTCGCTTCCTCTTCGCCAACGGCTCC
GCTGCCGAGAATCCGCTCCGGCCCTTTCCCCTCTTCGGCTCGACTTCGCTCCTCACGCCTTGGAGGGAGTTTGCG
TCGGCCATGGGACAGTTTGCCATTGCCGACTCGGCCCATTGGTGCGACGTCTGCGGGAAGAAGGACGGCGAGTGC
GCAGACCTCGTCAATCACTCTTCCTCCAAAGACGCCGACGATGCCCATGGTGACGACGGCGGGCATCATCATGGC
GGTGTTTCCAGGCCCGTTGCCGGCGTCATCGGCGCTCTCGTCACTCTCGTCGTCCTTCTCGCTGTCATTGCTGCC
GTTGTGCTGATTGGGGGACTGCGCTTCGTTCGCAACAAGCCTCGAGGGCCGCCGCCTGAGGAGACGGCTGATGCT
GCCATGGCCAAGGTCTGA
Transcript >Ophun1|6237
ATGGAGCTGCTCCTCGCCTCCCTCGTCCTGCTCCTGCAGCTGCTACGTCACGTCTCCGCCGCCGACGACCGCCTG
CTAGGCGTCTACATCTTCCACCGCCACGGCGACCGAACCGCCAAAGCCTGGAAGCCCGTCAATCTCACCGCGCTG
GGAGCCGTCCAGGTCCACTCGTCCGGCTCCTTCTACCGCGACCGCTACGTCACGGGCCCGGACGCCCTCCCCGGC
ATCAGCCCGGACCTGGCCGTCGCCTCTCAGCTGTCCGTGACGTCGCCGCGCGATCCCGTGCTGCAGGCCTCGGCG
CAGACCTTCGTCCAGGGCCTCTACCCCCCTGACGATACGCTGGCCGAGACGCTGGCCAATGGATCGAGCGTCGTG
GCTCCGCTGGGGGGGACGCAGTACGTGCCTGTTGACAAGGCCGAGACAAAGGCTGGCGATCGGCCGGAGGATAAT
GCTTGGTTGCAGGGGGGGAGTGGCTGTGTGAATGCCGAGGTCAGTTCGAATGCCTACCTTGCTTCGGCCGAGTAT
CGCCGAGATTATAGCGAGACGCTGGAGTTTTATCGGGGGTTGCTGCCTGTCATCAACGGCACGTATGGGGAGGAC
GAGGCCAACTTTAAGAATGGATATTCGATCTTCGACCTCATCAACGTCGCAACAATCCACAACTCCTCCATCCCC
TCCTCCTCCCTCCTCACATCCCAATCCCTCCACCGCCTCTACACCCTCGCCTCAACCCACGAATGGAACCTAGCC
TTCAACACCAGCTCCCCCATCCGCTCCATCGCCGGCGCCGTCCTCGCCGGCCAGATCCTCTCCTCCCTCGGCTCC
ATCGTCAACGCAGAGCCCTCGACCCCCCGTCTCCACGCCCAGTTCGGCGCCTACGCCACCTTCATGGCCTTCTTC
GGCCTCGCTCAACTCGATAAAGCCAGCCCGGACTTTTACGGCATCTGTCAGTACGCTTCTTCCATCGTCTTCGAA
CTCGTCGCCCCCAACCATCTCAACAAGCCCGGCCCGGATGACGTCTCCGTTCGCTTCCTCTTCGCCAACGGCTCC
GCTGCCGAGAATCCGCTCCGGCCCTTTCCCCTCTTCGGCTCGACTTCGCTCCTCACGCCTTGGAGGGAGTTTGCG
TCGGCCATGGGACAGTTTGCCATTGCCGACTCGGCCCATTGGTGCGACGTCTGCGGGAAGAAGGACGGCGAGTGC
GCAGACCTCGTCAATCACTCTTCCTCCAAAGACGCCGACGATGCCCATGGTGACGACGGCGGGCATCATCATGGC
GGTGTTTCCAGGCCCGTTGCCGGCGTCATCGGCGCTCTCGTCACTCTCGTCGTCCTTCTCGCTGTCATTGCTGCC
GTTGTGCTGATTGGGGGACTGCGCTTCGTTCGCAACAAGCCTCGAGGGCCGCCGCCTGAGGAGACGGCTGATGCT
GCCATGGCCAAGGTCTGA
Gene >Ophun1|6237
ATGGAGCTGCTCCTCGCCTCCCTCGTCCTGCTCCTGCAGCTGCTACGTCACGTCTCCGCCGCCGACGACCGCCTG
CTAGGCGTCTACATCTTCCACCGCCACGGCGACCGAACCGCCAAAGCCTGGAAGCCCGTCAATCTCACCGCGCTG
GGAGCCGTCCAGGTCCACTCGTCCGGCTCCTTCTACCGCGACCGCTACGTCACGGGCCCGGACGCCCTCCCCGGC
ATCAGCCCGGACCTGGCCGTCGCCTCTCAGCTGTCCGTGACGTCGCCGCGCGATCCCGTGCTGCAGGCCTCGGCG
CAGACCTTCGTCCAGGGCCTCTACCCCCCTGACGATACGCTGGCCGAGACGCTGGCCAATGGATCGAGCGTCGTG
GCTCCGCTGGGGGGGACGCAGTACGTGCCTGTTGACAAGGCCGAGACAAAGGCTGGCGATCGGCCGGAGGATAAT
GCTTGGTTGCAGGGGGGGAGTGGCTGTGTGAATGCCGAGGTCAGTTCGAATGCCTACCTTGCTTCGGCCGAGTAT
CGCCGAGATTATAGCGAGACGCTGGAGTTTTATCGGGGGTTGCTGCCTGTCATCAACGGCACGTATGGGGAGGAC
GAGGCCAACTTTAAGAATGGATATTCGAGTTTGTCCGCCCTTTTCTCCTCTCCTCTCTTCTCCTTCTCTCCTTTC
TCTCCTTTCTTTCCTCACATCTCACTAACATCCCCCAGTCTTCGACCTCATCAACGTCGCAACAATCCACAACTC
CTCCATCCCCTCCTCCTCCCTCCTCACATCCCAATCCCTCCACCGCCTCTACACCCTCGCCTCAACCCACGAATG
GAACCTAGCCTTCAACACCAGCTCCCCCATCCGCTCCATCGCCGGCGCCGTCCTCGCCGGCCAGATCCTCTCCTC
CCTCGGCTCCATCGTCAACGCAGAGCCCTCGACCCCCCGTCTCCACGCCCAGTTCGGCGCCTACGCCACCTTCAT
GGCCTTCTTCGGCCTCGCTCAACTCGATAAAGCCAGCCCGGACTTTTACGGCATCTGTCAGTACGCTTCTTCCAT
CGTCTTCGAACTCGTCGCCCCCAACCATCTCAACAAGCCCGGCCCGGATGACGTCTCCGTTCGCTTCCTCTTCGC
CAACGGCTCCGCTGCCGAGAATCCGCTCCGGCCCTTTCCCCTCTTCGGCTCGACTTCGCTCCTCACGCCTTGGAG
GGAGTTTGCGTCGGCCATGGGACAGTTTGCCATTGCCGACTCGGCCCATTGGTGCGACGTCTGCGGGAAGAAGGA
CGGCGAGTGCGCAGACCTCGTCAATCACTCTTCCTCCAAAGACGCCGACGATGCCCATGGTGACGACGGCGGGCA
TCATCATGGCGGTGTTTCCAGGCCCGTTGCCGGCGTCATCGGCGCTCTCGTCACTCTCGTCGTCCTTCTCGCTGT
CATTGCTGCCGTTGTGCTGATTGGGGGACTGCGCTTCGTTCGCAACAAGCCTCGAGGGCCGCCGCCTGAGGAGAC
GGCTGATGCTGCCATGGCCAAGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail