Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6234
Gene name
LocationContig_669:8086..9574
Strand-
Gene length (bp)1488
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.6E-18 32 368

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 20 391 7.0E-59
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 12 400 9.0E-57
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 12 400 9.0E-57
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 12 400 1.0E-54
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 21 385 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 20 391 7.0E-59
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 12 400 9.0E-57
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 12 400 9.0E-57
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 12 400 1.0E-54
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 21 385 3.0E-39
sp|Q9ZK41|GLUP_HELPJ Putative glucose/galactose transporter OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gluP PE=3 SV=1 30 385 3.0E-33
sp|O25788|GLUP_HELPY Putative glucose/galactose transporter OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gluP PE=3 SV=1 30 385 4.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 24 43 19
2 63 85 22
3 92 111 19
4 157 179 22
5 192 214 22
6 246 268 22
7 281 303 22
8 308 325 17
9 332 354 22
10 364 386 22
11 399 421 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6234
MAFLGLRPLRATSQPITLTTRQSLFPISLVTILFFLWGFSYGLLDTLNKHFQDVLHIDRARSAGLQAAYFGAYPL
ASVGHAAWILRYFGYRAVFIWGLCLYALGALLAIPALKAKTFEGFCACIFIIGNGLGSLETAANPFITVCGPPKH
AELRINASQAFNGIGSVVAPLLGSYIFFTNLSPQAAIDNVQWVYLSIAVFVLCLAAVFCFVDIPEITDDDMALRD
AESSAAQTPLYRNYRLFHAAFAQFCYAGSQIAIATFFINYAYSTRPGTDNAAAAKLFAGAQAAFAVGRFVGVGLM
RFVHPRRVFLAFVTCCLVFLGPSITQRGNVGVAMLYLVFFFESICFPTIVALGMRGLGRHTKRGSGFIIGGVVGG
ACVPPLTGFVGKRHGDGMAMMVPLLFLVGSWSYALCVNFVPAYTAVLDEEPKHPVIDDEDMDRPPSNEKLQGRHV
TTAC*
Coding >Ophun1|6234
ATGGCCTTCCTCGGCCTCCGCCCTCTCAGGGCAACATCCCAGCCCATCACGCTGACAACCCGCCAATCCCTCTTC
CCCATCTCCCTCGTAACAATCCTCTTCTTCCTCTGGGGCTTCAGCTACGGCCTCCTCGACACGCTCAACAAGCAT
TTCCAAGATGTCCTTCACATCGATCGCGCTCGCTCTGCAGGCCTCCAAGCCGCTTACTTTGGAGCCTATCCCCTC
GCTTCTGTAGGACACGCCGCCTGGATCCTCCGTTACTTCGGCTACCGCGCCGTCTTCATATGGGGTCTCTGTCTC
TACGCTCTGGGCGCGCTGCTCGCCATTCCCGCCCTCAAGGCAAAGACATTCGAGGGCTTCTGCGCATGCATCTTC
ATCATCGGCAATGGCCTCGGCTCGCTCGAGACGGCTGCTAACCCCTTCATCACCGTCTGCGGTCCGCCCAAGCAC
GCCGAGTTACGAATCAACGCCTCGCAGGCCTTCAACGGCATCGGCTCCGTCGTCGCCCCCCTCCTAGGCTCCTAC
ATCTTCTTCACCAACTTGAGTCCTCAGGCTGCCATTGACAATGTTCAGTGGGTCTATCTGTCCATCGCCGTCTTT
GTCTTGTGTCTAGCTGCCGTCTTTTGCTTCGTCGACATCCCTGAAATCACCGATGACGACATGGCCCTCCGCGAC
GCAGAGTCTTCAGCGGCTCAGACCCCCCTCTACCGCAACTATCGCCTCTTCCACGCCGCCTTCGCCCAGTTCTGC
TATGCCGGCTCCCAGATCGCCATCGCCACCTTCTTCATCAACTATGCCTATTCCACGAGGCCCGGAACCGACAAC
GCTGCGGCCGCCAAGCTCTTCGCCGGTGCTCAGGCTGCCTTTGCCGTTGGCCGCTTCGTCGGCGTCGGTCTCATG
CGCTTCGTCCATCCGCGTCGTGTCTTCCTCGCCTTCGTCACCTGCTGTCTCGTCTTCCTCGGCCCTTCCATCACC
CAGCGCGGCAACGTCGGAGTCGCCATGCTCTATCTCGTCTTCTTCTTCGAGTCAATCTGCTTCCCGACCATCGTC
GCCCTTGGCATGCGAGGCCTTGGTCGTCACACAAAGCGTGGCAGCGGCTTCATCATCGGTGGCGTCGTCGGTGGC
GCCTGTGTCCCTCCTCTGACCGGCTTCGTCGGCAAACGTCACGGCGACGGCATGGCCATGATGGTGCCTCTGCTC
TTCCTCGTCGGCTCCTGGTCCTATGCTCTATGCGTCAACTTCGTCCCGGCTTACACCGCTGTCCTCGACGAGGAG
CCCAAGCATCCCGTCATCGACGACGAGGATATGGACCGTCCTCCCTCAAACGAGAAGCTTCAAGGCCGTCACGTC
ACCACCGCCTGCTGA
Transcript >Ophun1|6234
ATGGCCTTCCTCGGCCTCCGCCCTCTCAGGGCAACATCCCAGCCCATCACGCTGACAACCCGCCAATCCCTCTTC
CCCATCTCCCTCGTAACAATCCTCTTCTTCCTCTGGGGCTTCAGCTACGGCCTCCTCGACACGCTCAACAAGCAT
TTCCAAGATGTCCTTCACATCGATCGCGCTCGCTCTGCAGGCCTCCAAGCCGCTTACTTTGGAGCCTATCCCCTC
GCTTCTGTAGGACACGCCGCCTGGATCCTCCGTTACTTCGGCTACCGCGCCGTCTTCATATGGGGTCTCTGTCTC
TACGCTCTGGGCGCGCTGCTCGCCATTCCCGCCCTCAAGGCAAAGACATTCGAGGGCTTCTGCGCATGCATCTTC
ATCATCGGCAATGGCCTCGGCTCGCTCGAGACGGCTGCTAACCCCTTCATCACCGTCTGCGGTCCGCCCAAGCAC
GCCGAGTTACGAATCAACGCCTCGCAGGCCTTCAACGGCATCGGCTCCGTCGTCGCCCCCCTCCTAGGCTCCTAC
ATCTTCTTCACCAACTTGAGTCCTCAGGCTGCCATTGACAATGTTCAGTGGGTCTATCTGTCCATCGCCGTCTTT
GTCTTGTGTCTAGCTGCCGTCTTTTGCTTCGTCGACATCCCTGAAATCACCGATGACGACATGGCCCTCCGCGAC
GCAGAGTCTTCAGCGGCTCAGACCCCCCTCTACCGCAACTATCGCCTCTTCCACGCCGCCTTCGCCCAGTTCTGC
TATGCCGGCTCCCAGATCGCCATCGCCACCTTCTTCATCAACTATGCCTATTCCACGAGGCCCGGAACCGACAAC
GCTGCGGCCGCCAAGCTCTTCGCCGGTGCTCAGGCTGCCTTTGCCGTTGGCCGCTTCGTCGGCGTCGGTCTCATG
CGCTTCGTCCATCCGCGTCGTGTCTTCCTCGCCTTCGTCACCTGCTGTCTCGTCTTCCTCGGCCCTTCCATCACC
CAGCGCGGCAACGTCGGAGTCGCCATGCTCTATCTCGTCTTCTTCTTCGAGTCAATCTGCTTCCCGACCATCGTC
GCCCTTGGCATGCGAGGCCTTGGTCGTCACACAAAGCGTGGCAGCGGCTTCATCATCGGTGGCGTCGTCGGTGGC
GCCTGTGTCCCTCCTCTGACCGGCTTCGTCGGCAAACGTCACGGCGACGGCATGGCCATGATGGTGCCTCTGCTC
TTCCTCGTCGGCTCCTGGTCCTATGCTCTATGCGTCAACTTCGTCCCGGCTTACACCGCTGTCCTCGACGAGGAG
CCCAAGCATCCCGTCATCGACGACGAGGATATGGACCGTCCTCCCTCAAACGAGAAGCTTCAAGGCCGTCACGTC
ACCACCGCCTGCTGA
Gene >Ophun1|6234
ATGGCCTTCCTCGGCCTCCGCCCTCTCAGGGCAACATCCCAGCCCATCACGCTGACAACCCGCCAATCCCTCTTC
CCCATCTCCCTCGTAACAATCCTCTTCTTCCTCTGGGGCTTCAGCTACGGCCTCCTCGACACGCTCAACAAGCAT
TTCCAAGATGTCCTTCACATCGATCGCGCTCGCTCTGCAGGCCTCCAAGCCGCTTACTTTGGGTTCGTCCCCTTC
ACCTCCACCTCACCGTCTTATAAACCCCAACATCTCTACAGAGCCTATCCCCTCGCTTCTGTAGGACACGCCGCC
TGGATCCTCCGTTACTTCGGCTACCGCGCCGTCTTCATATGGGGTCTCTGTCTCTACGCTCTGGGCGCGCTGCTC
GCCATTCCCGCCCTCAAGGCAAAGACATTCGAGGGCTTCTGCGCATGCATCTTCATCATCGGCAATGGCCTCGGC
TCGCTCGAGACGGCTGCTAACCCCTTCATCACCGTCTGCGGTCCGCCCAAGCACGCCGAGTTACGAATCAACGCC
TCGCAGGCCTTCAACGGCATCGGCTCCGTCGTCGCCCCCCTCCTAGGCTCCTACATCTTCTTCACCAACTTGAGT
CCTCAGGCTGCCATTGACAATGTTCAGTGGGTCTATCTGTCCATCGCCGTCTTTGTCTTGTGTCTAGCTGCCGTC
TTTTGCTTCGTCGACATCCCTGAAATCACCGATGACGGTAACCCTTCCCCCTTCCCCTGAACCCCCTATCCTCCT
CCAACGACTCGCCTCTGACATCTGTGTACAGACATGGCCCTCCGCGACGCAGAGTCTTCAGCGGCTCAGACCCCC
CTCTACCGCAACTATCGCCTCTTCCACGCCGCCTTCGCCCAGTTCTGCTATGCCGGCTCCCAGATCGCCATCGCC
ACCTTCTTCATCAACTATGCCTATTCCACGAGGCCCGGAACCGACAACGCTGCGGCCGCCAAGCTCTTCGCCGGT
GCTCAGGCTGCCTTTGCCGTTGGCCGCTTCGTCGGCGTCGGTCTCATGCGCTTCGTCCATCCGCGTCGTGTCTTC
CTCGCCTTCGTCACCTGCTGTCTCGTCTTCCTCGGCCCTTCCATCACCCAGCGCGGCAACGTCGGAGTCGCCATG
CTCTATCTCGTCTTCTTCTTCGAGTCAATCTGCTTCCCGACCATCGTCGCCCTTGGCATGCGAGGCCTTGGTCGT
CACACAAAGCGTGGCAGCGGCTTCATCATCGGTGGCGTCGTCGGTGGCGCCTGTGTCCCTCCTCTGACCGGCTTC
GTCGGCAAACGTCACGGCGACGGCATGGCCATGATGGTGCCTCTGCTCTTCCTCGTCGGCTCCTGGTCCTATGCT
CTATGCGTCAACTTCGTCCCGGCTTACACCGCTGTCCTCGACGAGGAGCCCAAGCATCCCGTCATCGACGACGAG
GATATGGACCGTCCTCCCTCAAACGAGAAGCTTCAAGGCCGTCACGTCACCACCGCCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail