Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6231
Gene name
LocationContig_668:9062..9515
Strand-
Gene length (bp)453
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon 3.8E-21 66 149

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6231
MGLRLATDASDDMMRRAVATAFAARAAELLTPQQGSLEASRAAERALTQHRGAARFVADVGVAGAHVDFILALQR
ALLRVAGGASKMGTLLSALLQQLYGLDVVDEEAILEWWADERAVEGDEGMVVLKERCAKLVEWLEDASEEDDDDE
*
Coding >Ophun1|6231
ATGGGCCTCCGCCTCGCAACCGACGCTTCGGACGACATGATGCGCCGCGCCGTAGCCACCGCCTTCGCCGCCCGC
GCCGCCGAGCTCCTCACCCCGCAGCAAGGCTCCCTCGAGGCCAGCCGCGCCGCCGAGCGAGCCCTCACCCAGCAC
CGCGGCGCCGCCCGCTTCGTCGCCGACGTGGGCGTCGCCGGCGCCCACGTCGACTTCATCCTTGCCTTACAGCGT
GCCCTGCTGCGCGTCGCGGGGGGGGCCTCTAAGATGGGAACCCTTCTTTCCGCCTTGCTGCAGCAGCTCTACGGG
CTGGATGTCGTGGACGAGGAGGCTATTCTTGAGTGGTGGGCTGATGAGAGGGCTGTTGAGGGTGATGAGGGCATG
GTTGTCTTGAAGGAGAGGTGTGCGAAGCTGGTTGAGTGGTTGGAAGATGCGTCCGAGGAGGACGACGATGATGAG
TAG
Transcript >Ophun1|6231
ATGGGCCTCCGCCTCGCAACCGACGCTTCGGACGACATGATGCGCCGCGCCGTAGCCACCGCCTTCGCCGCCCGC
GCCGCCGAGCTCCTCACCCCGCAGCAAGGCTCCCTCGAGGCCAGCCGCGCCGCCGAGCGAGCCCTCACCCAGCAC
CGCGGCGCCGCCCGCTTCGTCGCCGACGTGGGCGTCGCCGGCGCCCACGTCGACTTCATCCTTGCCTTACAGCGT
GCCCTGCTGCGCGTCGCGGGGGGGGCCTCTAAGATGGGAACCCTTCTTTCCGCCTTGCTGCAGCAGCTCTACGGG
CTGGATGTCGTGGACGAGGAGGCTATTCTTGAGTGGTGGGCTGATGAGAGGGCTGTTGAGGGTGATGAGGGCATG
GTTGTCTTGAAGGAGAGGTGTGCGAAGCTGGTTGAGTGGTTGGAAGATGCGTCCGAGGAGGACGACGATGATGAG
TAG
Gene >Ophun1|6231
ATGGGCCTCCGCCTCGCAACCGACGCTTCGGACGACATGATGCGCCGCGCCGTAGCCACCGCCTTCGCCGCCCGC
GCCGCCGAGCTCCTCACCCCGCAGCAAGGCTCCCTCGAGGCCAGCCGCGCCGCCGAGCGAGCCCTCACCCAGCAC
CGCGGCGCCGCCCGCTTCGTCGCCGACGTGGGCGTCGCCGGCGCCCACGTCGACTTCATCCTTGCCTTACAGCGT
GCCCTGCTGCGCGTCGCGGGGGGGGCCTCTAAGATGGGAACCCTTCTTTCCGCCTTGCTGCAGCAGCTCTACGGG
CTGGATGTCGTGGACGAGGAGGCTATTCTTGAGTGGTGGGCTGATGAGAGGGCTGTTGAGGGTGATGAGGGCATG
GTTGTCTTGAAGGAGAGGTGTGCGAAGCTGGTTGAGTGGTTGGAAGATGCGTCCGAGGAGGACGACGATGATGAG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail